Difference between revisions of "Os10g0553300"

From RiceWiki
Jump to: navigation, search
(Knowledge Extension)
 
(13 intermediate revisions by 5 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os10g0553300''''' was reported as '''''OsTPP2'''''. It is a member of '''TPS/TPP gene family''', '''''OsTPP2(Oryza sativa Trehalose-6-phosphate phosphatase2)''''' confers '''stress tolerance''' in rice<ref name="ref1"/><ref name="ref2"/>.
 +
 
 +
==Background==
 +
* Substantial levels of trehalose accumulate in bacteria, fungi, and invertebrates, where it serves as a storage carbohydrate or as a protectant against environmental stresses. In higher plants, trehalose is detected at fairly low levels; therefore, a regulatory or signaling function has been proposed for this molecule. In many organisms, trehalose-6-phosphate phosphatase is the enzyme governing the final step of trehalose biosynthesis. Here we report that OsTPP1 and OsTPP2 are the two major trehalose-6-phosphate phosphatase genes expressed in vegetative tissues of rice. Similar to results obtained from our previous OsTPP1 study, complementation analysis of a yeast trehalose-6-phosphate phosphatase mutant and activity measurement of the recombinant protein demonstrated that OsTPP2 encodes a functional trehalose-6-phosphate phosphatase enzyme.
 +
* Trehalose is a nonreducing disaccharide in which two glucose units are linked by an a,a-1,1-glycosidic linkage. The prevalent pathway for trehalose synthesis includes two enzymatic reactions. Trehalose 6-phos-phate (Tre6P) is generated from UDP-glucose and glucose 6-phosphate (Glc6P) in a reaction catalyzed by trehalose-6-phosphate synthase (TPS). Tre6P is then dephosphorylated to form trehalose via trehalose-6-phosphate phosphatase (TPP). In yeast, trehalose synthesis is carried out by a large enzyme complex that is composed of four subunits, including TPS1, TPS2, and regulatory subunits TSL1 and TPS3.
 +
* Although trehalose biosynthesis in higher plants has been demonstrated, details of both the physiologic functions and regulation of this pathway remain largely unknown. Genome sequencing of Arabidopsis and rice has revealed complex genomic organization of plant trehalose biosynthesis genes. Eleven putative TPS and 10 putative TPP genes were identified within the Arabidopsis genome, and nine putative TPS and nine putative TPP genes were found within the rice genome. Genetic studies have revealed that trehalose biosynthesis genes function specifically in regulating plant growth and development.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
*''OsTPP2'' encodes a functional trehalose-6-phosphate phosphatase enzyme. A full-length OsTPP2 cDNA was then isolated from root tissue by RT-PCR. The OsTPP2 gene contained an ORF encoding a 42.6 kDa protein with 382 amino acid residues<ref name="ref1"/>.
 +
 
 +
*Expression of ''OsTPP2'' was regulated by '''multiple stress factors''', such as '''chilling''', '''drought''', and '''salt''' stresses, as well as '''ABA''' treatment. Enzymatic characterization of recombinant ''OsTPP1'' and ''OsTPP2'' revealed stringent substrate specificity for trehalose 6-phosphate and about 10 times lower Km values for trehalose 6-phosphate as compared with trehalose-6-phosphate phosphatase enzymes from microorganisms<ref name="ref1"/>.
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824], [http://amigo.geneontology.org/amigo/term/GO:0005992 GO:0005992], [http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152]
 +
 
 +
===[[Os02g0661100|'''''OsTPP1''''']] and OsTPP2'''''===
 +
*'''Enzymatic characterization''' of recombinant ''OsTPP1'' and ''OsTPP2'' revealed '''stringent substrate specificity''' for trehalose 6-phosphate and about 10 times '''lower Km values''' for trehalose 6-phosphate as compared with trehalose-6-phosphate phosphatase enzymes from microorganisms<ref name="ref1"/>.
 +
*''OsTPP1'' and ''OsTPP2'' also clearly contrasted with microbial enzymes, in that they are generally unstable, almost completely losing activity when subjected to heat treatment at 50°C for 4 min. These characteristics of rice trehalose-6-phosphate phosphatase enzymes are '''consistent with very low cellular substrate concentration''' and '''tightly regulated gene expression'''<ref name="ref1"/>.
 +
*''OsTPP1'' and ''OsTPP2'' were the major TPP genes expressed in rice '''seedlings'''<ref name="ref1"/>.
 +
*Both ''OsTPP1'' and ''OsTPP2'' '''exhibited strong phosphatase activity upon Tre6P''', but almost no activity (less than 1% relative to Tre6P) was detected with any of the other sugar phosphates tested (data not shown).
 +
*'''The pH optima''' of OsTPP1 and OsTPP2 were approximately 7.0 and 6.5, respectively, whereas the enzymes had almost no activity at pH 5.5 or 9<ref name="ref1"/>.
 +
*Heat treatment at 50°C or higher for 4 min nearly eliminated both OsTPP1 and OsTPP2 activity, indicating that both enzymes are heat-labile<ref name="ref1"/>.
 +
 
 +
===Mutation===
 +
*yeast ''△tps2'' mutant<ref name="ref1"/>:
 +
Whereas wild-type cells grow at both 30°C and 36°C, growth of the ''△tps2'' mutant at 36°C was inhibited because of its inability
 +
to synthesize trehalose. The same mutant yeast strain transformed with ''OsTPP2'' recovered wild-type levels of growth at 36°C, suggesting that ''OsTPP2'' is a '''functional TPP enzyme''' in yeast cells.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
*''OsTPP2'' mRNA levels were detectable prior to stress treatments, and transiently increased in response to '''low temperature''', peaking at 10 h after the initiation of treatment in both '''shoot and root tissues'''. This expression pattern contrasted with the observed rapid induction of [[Os02g0661100|''OsTPP1'']] and gradual induction of ''OsMEK1''<ref name="ref3"/> in response to low temperature treatment<ref name="ref2"/><ref name="ref3"/>.
 +
*''Drought stress'' transiently induced ''OsTPP2'' expression, which peaked at 6 h in shoots and 2 h in roots. The induction of ''OsTPP2'' expression occurs earlier during stress treatment compared with expression of another drought-induced gene (''salT'') [25]. Treatment with 150 mm '''NaCl''' also induced OsTPP2 expression in roots, suggesting that stresses associated with water deficit similarly affect expression of this gene<ref name="ref1"/>.
 +
*However, in contrast to '''chilling and drought stress''' treatments, clear induction of ''OsTPP2'' was not observed in shoots, whereas the salt treatment effectively induced salT in both roots and shoots. Slight and transient induction of OsTPP2 was observed in roots and shoots in response to exogenous '''ABA'''. Together, these expression analyses indicated involvement of ''OsTPP2'' in '''multiple stress responses'''<ref name="ref3"/>.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
[[File: TPP Phylogenetic1.jpg|right|thumb|300px|'''Figure 1.''' ''Phylogenetic analysis of TPP domains.(from reference <ref name="ref4"/>).'']]
 +
*Phylogenetic analysis of the TPP domains demonstrated that the '''whole TPS/TPP gene family''' in rice was grouped into '''three''' classes (Class I/II/III)(Fig. 1). '''Class I''' consisted of '''''OsTPS1''''' which displayed high identity to '''''AtTPS1'''''<ref name="ref5"/> and '''''SlTPS1'''''<ref name="ref6"/>; '''Class II''' consisted of all the '''remaining OsTPSs'''; and '''Class III''' consisted of '''all independent TPP genes'''. The phylogenetic tree displayed a similar structure to that in ''Arabidopsis''<ref name="ref7"/>, suggesting the gene family was '''highly conserved''' and formed before the divergence of dicotyledonous and monocotyledonous angiosperms<ref name="ref1"/><ref name="ref4"/>.
 +
 +
*''OsTPP2'' belongs to '''Class III'''<ref name="ref4"/>.
  
You can also add sub-section(s) at will.
+
*'''Amino acid sequence homology''' between '''''OsTPP2''''' and '''''OsTPP1''''' was '''53%'''. Greater '''similarity''' was observed between OsTPP2 and ''Arabidopsis'' '''AtTPPA''' ('''57%'''). OsTPP2 contains '''two motifs''' shared by all TPP enzymes, known as phosphatase boxes<ref name="ref4"/>.
 +
 
 +
===Knowledge Extension===
 +
[[File: trehalose metabolic pathways1.jpg|left|thumb|300px|'''Figure 2.''' ''Identified trehalose metabolic pathways.(from reference <ref name="ref8"/>).'']]
 +
 
 +
* Although five different trehalose synthesis pathways exist in bacteria, fungi, yeast and algae, trehalose biosynthesis in higher plants only occurs in the trehalose phosphate synthase (TPS)–trehalose phosphate phosphatase(TPP) pathway (also known as OtsA–OtsB pathway)(Figure 2). The first step, catalyzed by TPS, involves the binding of a glucose-6-P to a UDP-glucose to produce T6P, which is cleaved into trehalose by TPP<ref name="ref9"/>. Trehalase breaks down trehalose to form two glucose residues. This process has been found in all organisms that synthesize trehalose<ref name="ref9"/>, even when distinct forms of trehalase coexist<ref name="ref10"/>.
 +
 
 +
* Trehalose is a disaccharide sugar '''widely distributed''' in bacteria, fungi, insects, plants and invertebrate animals. In microbes and yeast, trehalose is produced from glucose by trehalose-6-phosphate synthase (TPS) and trehalose-6-phosphate phosphatase (TPP), and serves as a sugar storage, metabolic regulator and protects against abiotic stress<ref name="ref10"/><ref name="ref11"/>. However, its role in plants is not yet fully elucidated<ref name="ref4"/><ref name="ref10"/><ref name="ref11"/>.
 +
 
 +
* Identification and functional characterization of trehalose biosynthesis genes have established trehalose biosynthesis in higher plants. However, low-level accumulation of trehalose in plants suggests a distinctive function of this substance compared with its role in other organisms. Organization of these trehalose biosynthesis genes is also quite unique in higher plants. Only one or two copies of TPS and TPP genes exist in most bacteria, fungi, and insects, whereas these genes constitute a large gene family in higher plants. For example, in Arabidopsis, 11 TPS and 10 TPP genes have been identified from genomic information, and nine TPS and nine TPP homologs are found in the rice genome.
 +
 
 +
* Using recombinant enzymes, we conducted the first detailed functional characterization of plant TPPs. These rice TPPs displayed three distinct properties compared with the previously characterized microbial TPPs. First, the K m values for the recombinant OsTPP1 and OsTPP2 enzymes are lower than values published for the microbial enzymes. Others have reported that the Tre6P concentration in Arabidopsis is relatively very low (10.1 ± 1.3 lgÆg )1 fresh weight). Therefore, these low K m values for OsTPP1 and OsTPP2 correlate with low concentrations of this substrate in plant cells.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Crop Cold Tolerance Research Team, National Agricultural Research Center for Hokkaido Region, National Agriculture and Food Research Organization, Hitsujigaoka 1, Toyohira-ku, Sapporo 0628555, Japan
 +
*Department of Crop Botany, Bangladesh Agricultural University, Mymensing, Bangladesh
 +
 
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Shima S, Matsui H, Tahara S, et al. Biochemical characterization of rice trehalose‐6‐phosphate phosphatases supports distinctive functions of these plant enzymes[J]. FEBS Journal, 2007, 274(5): 1192-1201.
 +
</ref>
 +
* <ref name="ref2">
 +
Pramanik M H R, Imai R. Functional identification of a trehalose 6-phosphate phosphatase gene that is involved in transient induction of trehalose biosynthesis during chilling stress in rice[J]. Plant molecular biology, 2005, 58(6): 751-762.
 +
</ref>
 +
* <ref name="ref3">
 +
Wen J Q, Oono K, Imai R. Two novel mitogen-activated protein signaling components, OsMEK1 and OsMAP1, are involved in a moderate low-temperature signaling pathway in rice[J]. Plant physiology, 2002, 129(4): 1880-1891.
 +
</ref>
 +
* <ref name="ref4">
 +
Ge L F, Chao D Y, Shi M, et al. Overexpression of the trehalose-6-phosphate phosphatase gene OsTPP1 confers stress tolerance in rice and results in the activation of stress responsive genes[J]. Planta, 2008, 228(1): 191-201.
 +
</ref>
 +
* <ref name="ref5">
 +
Blazquez M A, Santos E, Flores C, et al. Isolation and molecular characterization of the Arabidopsis TPS1 gene, encoding trehalose‐6‐phosphate synthase[J]. The Plant Journal, 1998, 13(5): 685-689.
 +
</ref>
 +
* <ref name="ref6">
 +
Zentella R, Mascorro-Gallardo J O, Van Dijck P, et al. A Selaginella lepidophylla Trehalose-6-Phosphate Synthase Complements Growth and Stress-Tolerance Defects in a Yeasttps1 Mutant[J]. Plant Physiology, 1999, 119(4): 1473-1482. 
 +
</ref>
 +
* <ref name="ref7">
 +
Leyman B, Van Dijck P, Thevelein J M. An unexpected plethora of trehalose biosynthesis genes in< i> Arabidopsis thaliana</i>[J]. Trends in plant science, 2001, 6(11): 510-513.
 +
</ref>
 +
* <ref name="ref8">
 +
Fernandez O, Béthencourt L, Quero A, et al. Trehalose and plant stress responses: friend or foe?[J]. Trends in plant science, 2010, 15(7): 409-417.
 +
</ref>
 +
* <ref name="ref9">
 +
Paul M J, Primavesi L F, Jhurreea D, et al. Trehalose metabolism and signaling[J]. Annu. Rev. Plant Biol., 2008, 59: 417-441.
 +
</ref>
 +
* <ref name="ref10">
 +
Wiemken A. Trehalose in yeast, stress protectant rather than reserve carbohydrate[J]. Antonie van Leeuwenhoek, 1990, 58(3): 209-217.
 +
</ref>
 +
* <ref name="ref11">
 +
Strom A R, Kaasen I. Trehalose metabolism in Escherichia coli: stress protection and stress regulation of gene expression[J]. Molecular microbiology, 1993, 8(2): 205-210.
 +
</ref>
 +
</references>
 +
==Structured Information==
  
==Structured Information==
 
{{JaponicaGene|
 
GeneName = Os10g0553300|
 
Description = Similar to Trehalose-6-phosphate phosphatase|
 
Version = NM_001071868.1 GI:115483331 GeneID:4349333|
 
Length = 3920 bp|
 
Definition = Oryza sativa Japonica Group Os10g0553300, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|
 
AP = Chromosome 10:22162334..22166253|
 
CDS = 22162652..22162702,22162816..22162908,22163004..22163144,22163239..22163316,22163405..22163506<br>,22163593..22163649,22163735..22163863,22163962..22164033,22164122..22164262<br>,22164345..22164629|
 
GCID = <gbrowseImage1>
 
name=NC_008403:22162334..22166253
 
source=RiceChromosome10
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008403:22162334..22166253
 
source=RiceChromosome10
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggatttgaagacaagcaactctcctgttattgctgatcctctccctaaattagccttgccatctgctgtgatgacgtacactacacctacgagtttcccctctaccgggctgtacttgaacactccgaaaaagaagcctctgcctggaaagatcgaagaagtccgcgccgctggatggcttgatctcatgctggcctcctcgccacctcgcaagaggcagactaaggactttgccaatgatgttcaagctgacgagcttgatttgctataccgtaattgggtggtgaaccatccatctgctttaacatcatttgaggatattgttaatcttgccagaggtaaaagattggcactgttccttgattatgatggaactctttcaccgattgtggacaatcctgaaaatgcagtaatgtctgacgagatgcgctctgctgtgaagcatgtggcatcactttttcccactgcgatcattagtggaagatctcgtgataaggtttttgactttgtgaaactaactgaactgtattacgctggaagtcatggaatggatatcatggggcctgttaggaagtctgattcgagtggtcagcatgtggaatgtatcaggtccactgattcagagggtaaagaggtcaacctcttccaacctgcaagtgagtttttacctatgattagcgaggtgtacaaaaagctcagtgaaagtattaaggacattgatggtgcaaggatggaagataacaaattctgtgtgtccgttcattaccgcaatgtagcaccacatgactacggagaagttcatcaacgtgtgactgccgtcctgaagaattacccttgtctaaggcttacccatgggagaaaggttcttgaggttcgacctgtgatagactggaacaaggggaaagctgtggaatttttgctggagtcacttggactatgtgggaaagaagatgttcttcctatctatgttggagatgacaagactgatgaggatgcattcaaggttctgaaggcaaacagcattggctttggaattttggtgtcatctgtgcccaaggatactgatgctttctattccgtacgggacccagctgaggtgatggaattcctgaagaaactggcatcttggaaggaggaatccacttaa</cdnaseq>|
 
AA = <aaseq>MDLKTSNSPVIADPLPKLALPSAVMTYTTPTSFPSTGLYLNTPK                    KKPLPGKIEEVRAAGWLDLMLASSPPRKRQTKDFANDVQADELDLLYRNWVVNHPSAL                    TSFEDIVNLARGKRLALFLDYDGTLSPIVDNPENAVMSDEMRSAVKHVASLFPTAIIS                    GRSRDKVFDFVKLTELYYAGSHGMDIMGPVRKSDSSGQHVECIRSTDSEGKEVNLFQP                    ASEFLPMISEVYKKLSESIKDIDGARMEDNKFCVSVHYRNVAPHDYGEVHQRVTAVLK                    NYPCLRLTHGRKVLEVRPVIDWNKGKAVEFLLESLGLCGKEDVLPIYVGDDKTDEDAF                    KVLKANSIGFGILVSSVPKDTDAFYSVRDPAEVMEFLKKLASWKEEST</aaseq>|
 
DNA = <dnaseqindica>3552..3602#3346..3438#3110..3250#2938..3015#2748..2849#2605..2661#2391..2519#2221..2292#1992..2132#1625..1909#gctccgccatcttctctcctctcccctctcactcctcccaaatcccctccattgccttcctcgcttcgcatcgccgctcccgccgccgccgtcgggctgctcgccggcattggggtaaggccggcctctctctccgggatcagcttctgctcttcccgttgtttgattgattgattgattgattttttttttggttttttgggtggggtttctgacgcgcgtggtgatgcggtggtgtgggaggtctagattagatctcgggtggggaggattgctcgtcgtgatcgggttgtgtgtgtgtgccattttttggcgtgttcgatggttggatgctcggtccacgtctgcgacggcggccacgagtttgagctgtccaaacccgggacgaaaccgaaaaaaaatatatgcaaatttgtttttggttcaattggtgggaaggcggaggacgaggacgaagacgaacagtagcagtagcttctcttgccgttttcctcaatttttgtttggatgcattagcaaggagaggacaaaaggatcctcttgtttttttcctttcaagaatttcttttttttatttgattgatgattttcgcagtacatatgggcttgtcgtcgcatataatgcgcgctgaaagttctggttggttggggggtttcctttcactgccgccgtttcggggaggcatgttgcatctgcctggccacatgacgcgagagcagattgattgattgatgcactgctgatccaatcgatgtgttagcgtcgtcggaatagataatcacccatcaatgcaacgaatgaatgatggaagtttcgacttttttttctttttaggtgctcctgttgagtgctcaacataagccatgtgcccttgtcctaaatttagctcatttgcatgtgtttattagctgttaattgatgagatttacaaagggatttccttgtctaagtttctttggattgataatgatggatgatggatgaaaagtcgttttccgactagttttttttggtgctacctaaagtgaatcaggcatcaccggttgagggcgtgccccatttttcattgtcgctcgggaatcttcagaccaaaagttgtactaattaatttccttttttaacttgcaaagacaaaaacagtaaccgtactgtagggcaatcagatcggtgttgtcagctcttcctgcattaggttatctggtgttctgttacataataaaggtttgtcgtctttgttctattgcagtgttggttgtgaccgtatacaattattgtttttggagctgagcgatcagatgcatgagccttccttttaaatgatctgtgtccaccatggcgatgaaccagtaggaacctgagcagtatgttatcatttttcagttattgtctttttttttggtagttgaaattattttcattattgcagaatgcaggaacttcccgcttaatgggctggatgcgttgtatgcacgtttgcagtgacaagaagacattgaaacgttggttttttattgacaagagggttggttgagtgtctaactcttaaggaatcctatagtctacttgcttgctcttgtgttgttagtaactgttcttacaacaactctgcggagagttctgttgatggatttgaagacaagcaactctcctgttattgctgatcctctccctaaattagccttgccatctgctgtgatgacgtacactacacctacgagtttcccctctaccgggctgtacttgaacactccgaaaaagaagcctctgcctggaaagatcgaagaagtccgcgccgctggatggcttgatctcatgctggcctcctcgccacctcgcaagaggcagactaaggactttgccaatgatgttcaagctgacgagcttgatttgctataccgtaattgggtggtatgtttttgaatctatagttattgctgaagtacatcaaacatggcaaacaataaaattttccactgtttttcttttgtaggtgaaccatccatctgctttaacatcatttgaggatattgttaatcttgccagaggtaaaagattggcactgttccttgattatgatggaactctttcaccgattgtggacaatcctgaaaatgcagtaatgtctgacgaggtattctttttctcctcttatgttctttagtcctcattattatcagtgaaaatttatctggcagttttgtaaatattctattcgacagatgcgctctgctgtgaagcatgtggcatcactttttcccactgcgatcattagtggaagatctcgtgataaggtaaggaatttatgttcacatgtaaaatactccccctgctaaccttttgcatttttcactctttgttgactctctcttatgtgtgttttgttctttaggtttttgactttgtgaaactaactgaactgtattacgctggaagtcatggaatggatatcatggggcctgttaggaagtctgattcgagtggtcagcatgtggaatgtatcaggtccactgattcagaggtgcaacagctttgttgattttttccacagacaaatttctctcttgtgacaaaattctaattagttattgctttttggctcatagggtaaagaggtcaacctcttccaacctgcaagtgagtttttacctatgattagcgaggtatgtatttccatctcgaacttggtaattattaggataccattttgtgttgcacggttgaaaattattcatttttatacctgtaggtgtacaaaaagctcagtgaaagtattaaggacattgatggtgcaaggatggaagataacaaattctgtgtgtccgttcattaccgcaatgtagcaccacatgtaagcctgcattgaagattttaatttcacacaggaaatatgtggtgtaaaatgtttgctgaatattattctcattgttacatcttaggactacggagaagttcatcaacgtgtgactgccgtcctgaagaattacccttgtctaaggcttacccatgggagaaaggtaaggaatatacacaaccgcacagctgtttcgaagcactggttaagtaccattgttgtatttgtttttaattcaactgcgctcttgaattcaggttcttgaggttcgacctgtgatagactggaacaaggggaaagctgtggaatttttgctggagtcacttggactatgtgggaaagaagatgttcttcctatctatgttggagatgacaagactgatgaggatgcattcaaggtaagccataaactggtctgcttgctcttacctgcaaaatatcaattactacttccatgtcttgatgtataatattgctcacttggctcaaataggttctgaaggcaaacagcattggctttggaattttggtgtcatctgtgcccaaggatactgatgctttctattccgtacgggacccagctgaggtaattcgtcttctatctgcattaagtaatctgtcgacaatagattctgaacaatctgatttggttacaatcattgaatcaactgagtatgaaaacattctttgtgtatttaggtgatggaattcctgaagaaactggcatcttggaaggaggaatccacttaagcagaagggaggaacataacagaatcgttttttgaggatatggagaagtaccaactataaatacgagcaaaatatacactgctaacaaataagtctggccaaaatgtttttgatttggcatcctattatataagaggctccctaaaccacccttttttggtctcactttcatcttatgtttctgggattctgagacatttcattcttttattagttctgttcctttagtatatataaaatatatacacatgtatgctgaaaaattttggttcctgtccctgtcgtcttaggcaattatttattctaccggcaagttgt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001071868.1 RefSeq:Os10g0553300]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 08:43, 1 July 2016

The rice Os10g0553300 was reported as OsTPP2. It is a member of TPS/TPP gene family, OsTPP2(Oryza sativa Trehalose-6-phosphate phosphatase2) confers stress tolerance in rice[1][2].

Background

  • Substantial levels of trehalose accumulate in bacteria, fungi, and invertebrates, where it serves as a storage carbohydrate or as a protectant against environmental stresses. In higher plants, trehalose is detected at fairly low levels; therefore, a regulatory or signaling function has been proposed for this molecule. In many organisms, trehalose-6-phosphate phosphatase is the enzyme governing the final step of trehalose biosynthesis. Here we report that OsTPP1 and OsTPP2 are the two major trehalose-6-phosphate phosphatase genes expressed in vegetative tissues of rice. Similar to results obtained from our previous OsTPP1 study, complementation analysis of a yeast trehalose-6-phosphate phosphatase mutant and activity measurement of the recombinant protein demonstrated that OsTPP2 encodes a functional trehalose-6-phosphate phosphatase enzyme.
  • Trehalose is a nonreducing disaccharide in which two glucose units are linked by an a,a-1,1-glycosidic linkage. The prevalent pathway for trehalose synthesis includes two enzymatic reactions. Trehalose 6-phos-phate (Tre6P) is generated from UDP-glucose and glucose 6-phosphate (Glc6P) in a reaction catalyzed by trehalose-6-phosphate synthase (TPS). Tre6P is then dephosphorylated to form trehalose via trehalose-6-phosphate phosphatase (TPP). In yeast, trehalose synthesis is carried out by a large enzyme complex that is composed of four subunits, including TPS1, TPS2, and regulatory subunits TSL1 and TPS3.
  • Although trehalose biosynthesis in higher plants has been demonstrated, details of both the physiologic functions and regulation of this pathway remain largely unknown. Genome sequencing of Arabidopsis and rice has revealed complex genomic organization of plant trehalose biosynthesis genes. Eleven putative TPS and 10 putative TPP genes were identified within the Arabidopsis genome, and nine putative TPS and nine putative TPP genes were found within the rice genome. Genetic studies have revealed that trehalose biosynthesis genes function specifically in regulating plant growth and development.

Annotated Information

Function

  • OsTPP2 encodes a functional trehalose-6-phosphate phosphatase enzyme. A full-length OsTPP2 cDNA was then isolated from root tissue by RT-PCR. The OsTPP2 gene contained an ORF encoding a 42.6 kDa protein with 382 amino acid residues[1].
  • Expression of OsTPP2 was regulated by multiple stress factors, such as chilling, drought, and salt stresses, as well as ABA treatment. Enzymatic characterization of recombinant OsTPP1 and OsTPP2 revealed stringent substrate specificity for trehalose 6-phosphate and about 10 times lower Km values for trehalose 6-phosphate as compared with trehalose-6-phosphate phosphatase enzymes from microorganisms[1].

GO assignment(s): GO:0003824, GO:0005992, GO:0008152

OsTPP1 and OsTPP2

  • Enzymatic characterization of recombinant OsTPP1 and OsTPP2 revealed stringent substrate specificity for trehalose 6-phosphate and about 10 times lower Km values for trehalose 6-phosphate as compared with trehalose-6-phosphate phosphatase enzymes from microorganisms[1].
  • OsTPP1 and OsTPP2 also clearly contrasted with microbial enzymes, in that they are generally unstable, almost completely losing activity when subjected to heat treatment at 50°C for 4 min. These characteristics of rice trehalose-6-phosphate phosphatase enzymes are consistent with very low cellular substrate concentration and tightly regulated gene expression[1].
  • OsTPP1 and OsTPP2 were the major TPP genes expressed in rice seedlings[1].
  • Both OsTPP1 and OsTPP2 exhibited strong phosphatase activity upon Tre6P, but almost no activity (less than 1% relative to Tre6P) was detected with any of the other sugar phosphates tested (data not shown).
  • The pH optima of OsTPP1 and OsTPP2 were approximately 7.0 and 6.5, respectively, whereas the enzymes had almost no activity at pH 5.5 or 9[1].
  • Heat treatment at 50°C or higher for 4 min nearly eliminated both OsTPP1 and OsTPP2 activity, indicating that both enzymes are heat-labile[1].

Mutation

  • yeast △tps2 mutant[1]:

Whereas wild-type cells grow at both 30°C and 36°C, growth of the △tps2 mutant at 36°C was inhibited because of its inability to synthesize trehalose. The same mutant yeast strain transformed with OsTPP2 recovered wild-type levels of growth at 36°C, suggesting that OsTPP2 is a functional TPP enzyme in yeast cells.

Expression

  • OsTPP2 mRNA levels were detectable prior to stress treatments, and transiently increased in response to low temperature, peaking at 10 h after the initiation of treatment in both shoot and root tissues. This expression pattern contrasted with the observed rapid induction of OsTPP1 and gradual induction of OsMEK1[3] in response to low temperature treatment[2][3].
  • Drought stress transiently induced OsTPP2 expression, which peaked at 6 h in shoots and 2 h in roots. The induction of OsTPP2 expression occurs earlier during stress treatment compared with expression of another drought-induced gene (salT) [25]. Treatment with 150 mm NaCl also induced OsTPP2 expression in roots, suggesting that stresses associated with water deficit similarly affect expression of this gene[1].
  • However, in contrast to chilling and drought stress treatments, clear induction of OsTPP2 was not observed in shoots, whereas the salt treatment effectively induced salT in both roots and shoots. Slight and transient induction of OsTPP2 was observed in roots and shoots in response to exogenous ABA. Together, these expression analyses indicated involvement of OsTPP2 in multiple stress responses[3].

Evolution

Figure 1. Phylogenetic analysis of TPP domains.(from reference [4]).
  • Phylogenetic analysis of the TPP domains demonstrated that the whole TPS/TPP gene family in rice was grouped into three classes (Class I/II/III)(Fig. 1). Class I consisted of OsTPS1 which displayed high identity to AtTPS1[5] and SlTPS1[6]; Class II consisted of all the remaining OsTPSs; and Class III consisted of all independent TPP genes. The phylogenetic tree displayed a similar structure to that in Arabidopsis[7], suggesting the gene family was highly conserved and formed before the divergence of dicotyledonous and monocotyledonous angiosperms[1][4].
  • OsTPP2 belongs to Class III[4].
  • Amino acid sequence homology between OsTPP2 and OsTPP1 was 53%. Greater similarity was observed between OsTPP2 and Arabidopsis AtTPPA (57%). OsTPP2 contains two motifs shared by all TPP enzymes, known as phosphatase boxes[4].

Knowledge Extension

Figure 2. Identified trehalose metabolic pathways.(from reference [8]).
  • Although five different trehalose synthesis pathways exist in bacteria, fungi, yeast and algae, trehalose biosynthesis in higher plants only occurs in the trehalose phosphate synthase (TPS)–trehalose phosphate phosphatase(TPP) pathway (also known as OtsA–OtsB pathway)(Figure 2). The first step, catalyzed by TPS, involves the binding of a glucose-6-P to a UDP-glucose to produce T6P, which is cleaved into trehalose by TPP[9]. Trehalase breaks down trehalose to form two glucose residues. This process has been found in all organisms that synthesize trehalose[9], even when distinct forms of trehalase coexist[10].
  • Trehalose is a disaccharide sugar widely distributed in bacteria, fungi, insects, plants and invertebrate animals. In microbes and yeast, trehalose is produced from glucose by trehalose-6-phosphate synthase (TPS) and trehalose-6-phosphate phosphatase (TPP), and serves as a sugar storage, metabolic regulator and protects against abiotic stress[10][11]. However, its role in plants is not yet fully elucidated[4][10][11].
  • Identification and functional characterization of trehalose biosynthesis genes have established trehalose biosynthesis in higher plants. However, low-level accumulation of trehalose in plants suggests a distinctive function of this substance compared with its role in other organisms. Organization of these trehalose biosynthesis genes is also quite unique in higher plants. Only one or two copies of TPS and TPP genes exist in most bacteria, fungi, and insects, whereas these genes constitute a large gene family in higher plants. For example, in Arabidopsis, 11 TPS and 10 TPP genes have been identified from genomic information, and nine TPS and nine TPP homologs are found in the rice genome.
  • Using recombinant enzymes, we conducted the first detailed functional characterization of plant TPPs. These rice TPPs displayed three distinct properties compared with the previously characterized microbial TPPs. First, the K m values for the recombinant OsTPP1 and OsTPP2 enzymes are lower than values published for the microbial enzymes. Others have reported that the Tre6P concentration in Arabidopsis is relatively very low (10.1 ± 1.3 lgÆg )1 fresh weight). Therefore, these low K m values for OsTPP1 and OsTPP2 correlate with low concentrations of this substrate in plant cells.

Labs working on this gene

  • Crop Cold Tolerance Research Team, National Agricultural Research Center for Hokkaido Region, National Agriculture and Food Research Organization, Hitsujigaoka 1, Toyohira-ku, Sapporo 0628555, Japan
  • Department of Crop Botany, Bangladesh Agricultural University, Mymensing, Bangladesh


References

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 Shima S, Matsui H, Tahara S, et al. Biochemical characterization of rice trehalose‐6‐phosphate phosphatases supports distinctive functions of these plant enzymes[J]. FEBS Journal, 2007, 274(5): 1192-1201.
  2. 2.0 2.1 Pramanik M H R, Imai R. Functional identification of a trehalose 6-phosphate phosphatase gene that is involved in transient induction of trehalose biosynthesis during chilling stress in rice[J]. Plant molecular biology, 2005, 58(6): 751-762.
  3. 3.0 3.1 3.2 Wen J Q, Oono K, Imai R. Two novel mitogen-activated protein signaling components, OsMEK1 and OsMAP1, are involved in a moderate low-temperature signaling pathway in rice[J]. Plant physiology, 2002, 129(4): 1880-1891.
  4. 4.0 4.1 4.2 4.3 4.4 Ge L F, Chao D Y, Shi M, et al. Overexpression of the trehalose-6-phosphate phosphatase gene OsTPP1 confers stress tolerance in rice and results in the activation of stress responsive genes[J]. Planta, 2008, 228(1): 191-201.
  5. Blazquez M A, Santos E, Flores C, et al. Isolation and molecular characterization of the Arabidopsis TPS1 gene, encoding trehalose‐6‐phosphate synthase[J]. The Plant Journal, 1998, 13(5): 685-689.
  6. Zentella R, Mascorro-Gallardo J O, Van Dijck P, et al. A Selaginella lepidophylla Trehalose-6-Phosphate Synthase Complements Growth and Stress-Tolerance Defects in a Yeasttps1 Mutant[J]. Plant Physiology, 1999, 119(4): 1473-1482.
  7. Leyman B, Van Dijck P, Thevelein J M. An unexpected plethora of trehalose biosynthesis genes in< i> Arabidopsis thaliana</i>[J]. Trends in plant science, 2001, 6(11): 510-513.
  8. Fernandez O, Béthencourt L, Quero A, et al. Trehalose and plant stress responses: friend or foe?[J]. Trends in plant science, 2010, 15(7): 409-417.
  9. 9.0 9.1 Paul M J, Primavesi L F, Jhurreea D, et al. Trehalose metabolism and signaling[J]. Annu. Rev. Plant Biol., 2008, 59: 417-441.
  10. 10.0 10.1 10.2 Wiemken A. Trehalose in yeast, stress protectant rather than reserve carbohydrate[J]. Antonie van Leeuwenhoek, 1990, 58(3): 209-217.
  11. 11.0 11.1 Strom A R, Kaasen I. Trehalose metabolism in Escherichia coli: stress protection and stress regulation of gene expression[J]. Molecular microbiology, 1993, 8(2): 205-210.

Structured Information