Difference between revisions of "Os01g0192000"

From RiceWiki
Jump to: navigation, search
 
(61 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice ''Os01g0192000'' is located at rice chromosome 1, which is involved in delaying leaf senescence in rice.  It was reported as '''''OsDOS'''''  by Chinese plant molecular biologists in 2006.
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:Os01g0192000-1.png|right|thumb|274px|'''Figure 1.''' ''OsDOS mutant (RNAi) VS. WT(from reference) <ref name="ref1" />.'']]
 
===Function===
 
===Function===
Please input function information here.
+
* Leaf senescence is a developmentally programmed degeneration process that constitutes the final step of leaf development and is controlled by multiple developmental and environmental signals.
 +
* Research shows that '''''OsDOS''''' acts as a novel negative regulator for leaf senescence by integrating developmental cues to senescence signaling cascades including the JA pathway.
 +
* Scientists propose that '''''OsDOS''''' possibly plays a role at posttranscriptional level in delaying leaf senescence in rice. And the potential targets of '''''OsDOS''''' might be key positive elements that are required to promote the leaf senescence program.
 +
<br>
 +
'''GO asignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0001591 GO:0003676], [http://amigo.geneontology.org/amigo/term/GO:0008270 GO:0008270]
  
===Expression===
+
===Wild Type & Mutants===
Please input expression information here.
+
* '''RNAi interference of the''' '''''OsDOS'''''. The RNAi T 1 lines appeared normal during the vegetative growth. However, beginning at the time of late booting stage, slight but consistent leaf yellowing was clearly observed in the RNAi lines and then an accelerated leaf senescence occurred compared with that in the wild-type plants.
 +
* At the grainfilling stage, striking leaf yellowing appeared in the whole plant, except the flag leaf showing a slightly less yellowing, and the senescence symptom was correlated with the reduction of the expression level of OsDOS.
 +
<br>[[File:Os01g0192000-3.png|center|thumb|1000px|'''Figure 2.''' ''Gene structure of Os01g0192000'']]
 +
* Compared with the OsDOS RNAi lines, the wild-type plants stayed much more green.
 +
[[File:Os01g0192000-2.png|right|thumb|274px|'''Figure 3.''' ''OsDOS (Overexpression) mutant VS. WT(from reference) <ref name="ref1" />.'']]
 +
* '''Overexpression of the ''OsDOS'''''.  The OsDOS OX lines showed a delay in growth, shorter stature, abnormally developed panicle, deferred heading, and severe sterility. 
 +
* The florets of the OsDOS OX lines was found failed to open or scarcely opened after heading. Further phenotypic analysis showed that defects in anther dehiscence and pollen viability may be responsible for the severe sterility of the OX lines.
 +
* Together, these results indicated that the ectopic overexpression of OsDOS has a pleiotropic impact on rice development.
  
===Evolution===
+
===Expression Pattern===
Please input evolution information here.
+
* Real-time PCR analysis was performed to examine the expression profile of '''''OsDOS'''''. The  '''''OsDOS''''' transcripts were detected throughout the plant, in panicles and leaves with a higher expression at the early stages. the temporal expression profiles of the OsDOS transcripts indicated a down-regulation of the OsDOS gene expression during natural leaf senescence. Down-regulation of the '''''OsDOS''''' expression also occurred during the panicle development process. In addition, the expression level of '''''OsDOS''''' was reduced after pollination
 
+
* RNA in situ hybridization analysis was also conducted to further examine tissue-specific expression patterns of '''''OsDOS'''''. Strong OsDOS expression was detected in the leaf primordium, incipient leaf, and shoot meristem, but weak expression was observed in the elder leaf tissue
You can also add sub-section(s) at will.
+
[[File:Os01g0192000-4.png|right|thumb|274px|'''Figure 4.''' ''Expression patterns of OsDOS(from reference) <ref name="ref1" />.'']]
 +
===Subcellular Localization===
 +
* To examine the subcellular localization of OsDOS, a green fluorescent protein (GFP) reporter gene was fused in frame to the last codon of the OsDOS coding region to produce an OsDOS-GFP fusion protein in transgenic rice plants. And the OsDOS-GFP green fluorescent signal was detected predominantly in the nuclei of the transgenic rice plants. These results indicate that OsDOS is a nuclear-localized protein and presumably functions as a transcript regulator as predicted for other CCCH-type proteins.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Laboratory of Molecular and Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100080, China.
 +
* National Centre for Plant Gene Research, Beijing 100080, China
 +
* Graduate University of Chinese Academy of Sciences, Beijing 100049, China
 +
* College of Life Sciences, Tianjin Normal University, Tianjin 300074, China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 
+
<ref name="ref1">
 +
Kong Z, Li M, Yang W, Xu W, Xue Y. A novel nuclear-localized CCCH-type zinc finger protein, OsDOS, is involved in delaying leaf senescence in rice. Plant Physiol. 2006 Aug;141(4):1376-88. Epub 2006 Jun 15. PubMed PMID: 16778011
 +
</ref>
 +
</references>
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
GeneName = Os01g0192000|
 
Description = Similar to Zinc finger transcription factor|
 
Version = NM_001048811.1 GI:115435035 GeneID:4327304|
 
Length = 1991 bp|
 
Definition = Oryza sativa Japonica Group Os01g0192000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:4948133..4950123|
 
CDS = 4948852..4950012|
 
GCID = <gbrowseImage1>
 
name=NC_008394:4948133..4950123
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:4948133..4950123
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgatgatgatgggggaaggagtcagcagcgtcccgccgtggtctcacctccccgtgagcggagtcgatgtactcggcggcggtggtggcggtggggatgagatgacgccgtacgtgatcgccgcgctgcgggattacctgccggcgaatgatgtcggggtgggggctgacgaggaggaggaggccgcggcgatggccgcggcggtggacgcgtacgcgtgcgacgagttccggatgtacgagttcaaggtgcggcggtgcgcgcgcgggcggagccatgactggaccgagtgccccttcgcgcacccgggggagaaggcgcgccgccgcgatccgcgcaagtaccactactccggcaccgcgtgcccggacttccgcaagggcgggtgcaagcgcggcgacgcctgcgagtacgcccacggcgtgtttgagtgttggctccacccggcgcgctaccgcacccagccgtgcaaggacggcaccgcctgccgccgccgcgtctgcttcttcgcccacaccccggaccagctccgcgtcctcccggcgcagcagtccagccccaggagcgtggcgtcctcgccgctggccgagtcctacgacggctcgccgctgcgccgccaggcgttcgagagctacctcaccaagaccatcatgtcctcgtccccgaccagcaccctcatgtctccgcccaagtcgcccccgtcggagtccccgccattgtcgcccgacggtgccgcggccatccgtcgcggatcttggcccggcgtcggctcgccggtgaacgacgtcctggcctcgttccgccagctccgcctcaacaaggtgaagtcgtcgccgtccggcgggtggagctacccttcgtcgtccgccgtctacgggtctcccaaggccgccaccggcctctacagcctccccaccactccactggcttccacggcaacggtgaccaccgcctccagcttcatgcccaacctggagccactggacctcgggctcatcggcgacgaggagccggtccagagggtggagtccggaagagccctccgggagaaggtgttcgagcgactgagccgggatggtgccatctccggcgacgccacagccttcgccaccgccggtgttggcctcgacgttgattgggtgtccgacctcatcaactga</cdnaseq>|
 
AA = <aaseq>MMMMGEGVSSVPPWSHLPVSGVDVLGGGGGGGDEMTPYVIAALR                    DYLPANDVGVGADEEEEAAAMAAAVDAYACDEFRMYEFKVRRCARGRSHDWTECPFAH                    PGEKARRRDPRKYHYSGTACPDFRKGGCKRGDACEYAHGVFECWLHPARYRTQPCKDG                    TACRRRVCFFAHTPDQLRVLPAQQSSPRSVASSPLAESYDGSPLRRQAFESYLTKTIM                    SSSPTSTLMSPPKSPPSESPPLSPDGAAAIRRGSWPGVGSPVNDVLASFRQLRLNKVK                    SSPSGGWSYPSSSAVYGSPKAATGLYSLPTTPLASTATVTTASSFMPNLEPLDLGLIG                    DEEPVQRVESGRALREKVFERLSRDGAISGDATAFATAGVGLDVDWVSDLIN</aaseq>|
 
DNA = <dnaseqindica>112..1272#gccttacacatcgcaccactctctcttactcgtccatacgccgagtccacgagatctcgccgtagtccatacaccggttgatcggaggtcgtgttgccgccggcggtggccatgatgatgatgggggaaggagtcagcagcgtcccgccgtggtctcacctccccgtgagcggagtcgatgtactcggcggcggtggtggcggtggggatgagatgacgccgtacgtgatcgccgcgctgcgggattacctgccggcgaatgatgtcggggtgggggctgacgaggaggaggaggccgcggcgatggccgcggcggtggacgcgtacgcgtgcgacgagttccggatgtacgagttcaaggtgcggcggtgcgcgcgcgggcggagccatgactggaccgagtgccccttcgcgcacccgggggagaaggcgcgccgccgcgatccgcgcaagtaccactactccggcaccgcgtgcccggacttccgcaagggcgggtgcaagcgcggcgacgcctgcgagtacgcccacggcgtgtttgagtgttggctccacccggcgcgctaccgcacccagccgtgcaaggacggcaccgcctgccgccgccgcgtctgcttcttcgcccacaccccggaccagctccgcgtcctcccggcgcagcagtccagccccaggagcgtggcgtcctcgccgctggccgagtcctacgacggctcgccgctgcgccgccaggcgttcgagagctacctcaccaagaccatcatgtcctcgtccccgaccagcaccctcatgtctccgcccaagtcgcccccgtcggagtccccgccattgtcgcccgacggtgccgcggccatccgtcgcggatcttggcccggcgtcggctcgccggtgaacgacgtcctggcctcgttccgccagctccgcctcaacaaggtgaagtcgtcgccgtccggcgggtggagctacccttcgtcgtccgccgtctacgggtctcccaaggccgccaccggcctctacagcctccccaccactccactggcttccacggcaacggtgaccaccgcctccagcttcatgcccaacctggagccactggacctcgggctcatcggcgacgaggagccggtccagagggtggagtccggaagagccctccgggagaaggtgttcgagcgactgagccgggatggtgccatctccggcgacgccacagccttcgccaccgccggtgttggcctcgacgttgattgggtgtccgacctcatcaactgaggcttccaagtcgctattggaagccccttttgtgagcatcaaggatgatggcatggaggaggagaaggtggcggtaagaagaaaatgatggcacgacaaaaaaatccttcattttcttttgtgatttcaagtcaagtttctactaattcctgtacatatctatctcccatgtgaatattcatggttggtggagaggaggcaagtatggaaagatgggtggatttgttttggggttttgaggtagtagcaaaattacccacaaaaaaattaggtgaaaaaaaaaagaggagtagaaatggaggtgattcagtgtctcctgtgtgcatagggtgtgtggaggtgaaggaagcacggaaggaagaagatcatggcggaagaagatggccggatttcggccgccgtcgcggcggcggccctgcctatttcagtgatttctgggggtttatcctctgttcatcgtttgttgcatcatcgactagctgatgaagatcgtcgatcgatttcaatcaagccccccctcttgttgatttcctattttgttgatgtaatctttgttttgttaagaacccccaacagcatattttgtaccttagctttaaatctgaaaatcttttgctgactcatctacctatatgtggtgatgaagcccccctcaatgtattgtaatcacctgcttcaagtaaatgatccaataatattatgttgctatatgtttcatt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001048811.1 RefSeq:Os01g0192000]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 1]]
 
[[Category:Chromosome 1]]
 

Latest revision as of 08:56, 1 July 2016

The rice Os01g0192000 is located at rice chromosome 1, which is involved in delaying leaf senescence in rice. It was reported as OsDOS by Chinese plant molecular biologists in 2006.

Annotated Information

Figure 1. OsDOS mutant (RNAi) VS. WT(from reference) [1].

Function

  • Leaf senescence is a developmentally programmed degeneration process that constitutes the final step of leaf development and is controlled by multiple developmental and environmental signals.
  • Research shows that OsDOS acts as a novel negative regulator for leaf senescence by integrating developmental cues to senescence signaling cascades including the JA pathway.
  • Scientists propose that OsDOS possibly plays a role at posttranscriptional level in delaying leaf senescence in rice. And the potential targets of OsDOS might be key positive elements that are required to promote the leaf senescence program.


GO asignment(s): GO:0003676, GO:0008270

Wild Type & Mutants

  • RNAi interference of the OsDOS. The RNAi T 1 lines appeared normal during the vegetative growth. However, beginning at the time of late booting stage, slight but consistent leaf yellowing was clearly observed in the RNAi lines and then an accelerated leaf senescence occurred compared with that in the wild-type plants.
  • At the grainfilling stage, striking leaf yellowing appeared in the whole plant, except the flag leaf showing a slightly less yellowing, and the senescence symptom was correlated with the reduction of the expression level of OsDOS.

Figure 2. Gene structure of Os01g0192000
  • Compared with the OsDOS RNAi lines, the wild-type plants stayed much more green.
Figure 3. OsDOS (Overexpression) mutant VS. WT(from reference) [1].
  • Overexpression of the OsDOS. The OsDOS OX lines showed a delay in growth, shorter stature, abnormally developed panicle, deferred heading, and severe sterility.
  • The florets of the OsDOS OX lines was found failed to open or scarcely opened after heading. Further phenotypic analysis showed that defects in anther dehiscence and pollen viability may be responsible for the severe sterility of the OX lines.
  • Together, these results indicated that the ectopic overexpression of OsDOS has a pleiotropic impact on rice development.

Expression Pattern

  • Real-time PCR analysis was performed to examine the expression profile of OsDOS. The OsDOS transcripts were detected throughout the plant, in panicles and leaves with a higher expression at the early stages. the temporal expression profiles of the OsDOS transcripts indicated a down-regulation of the OsDOS gene expression during natural leaf senescence. Down-regulation of the OsDOS expression also occurred during the panicle development process. In addition, the expression level of OsDOS was reduced after pollination
  • RNA in situ hybridization analysis was also conducted to further examine tissue-specific expression patterns of OsDOS. Strong OsDOS expression was detected in the leaf primordium, incipient leaf, and shoot meristem, but weak expression was observed in the elder leaf tissue
Figure 4. Expression patterns of OsDOS(from reference) [1].

Subcellular Localization

  • To examine the subcellular localization of OsDOS, a green fluorescent protein (GFP) reporter gene was fused in frame to the last codon of the OsDOS coding region to produce an OsDOS-GFP fusion protein in transgenic rice plants. And the OsDOS-GFP green fluorescent signal was detected predominantly in the nuclei of the transgenic rice plants. These results indicate that OsDOS is a nuclear-localized protein and presumably functions as a transcript regulator as predicted for other CCCH-type proteins.

Labs working on this gene

  • Laboratory of Molecular and Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100080, China.
  • National Centre for Plant Gene Research, Beijing 100080, China
  • Graduate University of Chinese Academy of Sciences, Beijing 100049, China
  • College of Life Sciences, Tianjin Normal University, Tianjin 300074, China

References

  1. 1.0 1.1 1.2 Kong Z, Li M, Yang W, Xu W, Xue Y. A novel nuclear-localized CCCH-type zinc finger protein, OsDOS, is involved in delaying leaf senescence in rice. Plant Physiol. 2006 Aug;141(4):1376-88. Epub 2006 Jun 15. PubMed PMID: 16778011

Structured Information