Difference between revisions of "Os11g0267000"

From RiceWiki
Jump to: navigation, search
(Function)
 
(11 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os11g0267000''''' was reported as '''''OsGUN4''''' (genomes uncoupled 4) in 2014 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os11g0267000''''' '''<=>''' '''''OsGUN4'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* For easy testing and to increase varietal purity, a xantha mutation (xnt), which turns plants yellow and makes them visually distinguishable from normal green rice, has been generated and bred into male sterile lines for hybrid rice production.
 +
* we have identified an epi-allele of '''''OsGUN4''''' as the causal gene of the xantha marker trait and revealed that enhanced methylation in its promoter down-regulated its expression in rice.
 +
 
  
===Expression===
 
Please input expression information here.
 
  
===Evolution===
+
[[File:Os11g0267000_1.png|center|thumb|800px|'''Figure 2.''' ''Analysis of the rice GUN4 gene and its mutations. a Schematic diagram of the OsGUN4 locus.<ref name="ref1" />.'']]
Please input evolution information here.
 
  
You can also add sub-section(s) at will.
+
===Expression===
 +
* The expression of OsGUN4 was significantly reduced in HYB compared with LTB in terms of both transcript abundance (0.2 % that of LTB) and expressed protein level (barely detectable in HYB but greater than the heat shock protein reference in LTB).
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* National Key Laboratory of Rice Biology, Institute of Crop Sciences, Zhejiang University, 310029 Hangzhou, China
 +
* Jiaxing Academy of Agricultural Sciences, 314016 Jiaxing, Zhejiang, China
 +
* College of Life Science, Hebei Agricultural University, 071001 Baoding, China
 +
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Li RQ, Huang JZ, Zhao HJ, Fu HW, Li YF, Liu GZ, Shu QY. A down-regulated epi-allele of the genomes uncoupled 4 gene generates a xantha marker trait in rice. Theor Appl Genet. 2014 Nov;127(11):2491-501. doi:10.1007/s00122-014-2393-9. Epub 2014 Sep 11. PubMed PMID: 25208645.
 +
</ref>
 +
 
 +
</references>
  
==References==
 
Please input cited references here.
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 11]]
GeneName = Os11g0267000|
 
Description = GUN4-like domain containing protein|
 
Version = NM_001074200.1 GI:115485048 GeneID:4350255|
 
Length = 1232 bp|
 
Definition = Oryza sativa Japonica Group Os11g0267000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
 
AP = Chromosome 11:9221867..9223098|
 
CDS = 9222090..9222911|
 
GCID = <gbrowseImage1>
 
name=NC_008404:9221867..9223098
 
source=RiceChromosome11
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008404:9221867..9223098
 
source=RiceChromosome11
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcaaatgcttccctccaatcctttcttcttcaccaccaccattctttccttagcaatggtatccatgagggctcctccccttctataattctcaagctcacaacaaacagcaacagcagcatttcattcaagctcttctccaacaccacctcctcctcatcatcatcagtgaccaccacagcatcaacccccaactcaccggtgacccctgctccggtaacagcctcgtctccgccaccgccttcgctggagctcctgggcgcccagctcgccgagagggattaccggcaggccgacgagaccacccgcgcgctcctcatcgagctcgcgggcgagccagctcggcgccgagggtacgtcttcttctcggaggtgcagttcatctccgccgatgacctccgggccatcgacgcgctctggcaggagcacagcggtggccggttcgggtacagcgtgcagcggcggctgtgggagaagtcgcggcgcgacttcacccgcttcttcatcagggttgggtggatgaagaagcttgacaccgaggtggagcagttcaactacagggccttccctgatgagttcatctgggagctgaatgatgacacgccagaggggcatctccctctcaccaatgccctcagagggacacagctcctgggcaacatcttcacacatcctgcctttgaagaggagcaagaagatgaattagcagcagaggagaatgacacacctgataacactggtcagagtaaggatggcagcaaagggaaggagaggccaaagttcatgagagatttcttcaagcctgactactccttttga</cdnaseq>|
 
AA = <aaseq>MANASLQSFLLHHHHSFLSNGIHEGSSPSIILKLTTNSNSSISF                    KLFSNTTSSSSSSVTTTASTPNSPVTPAPVTASSPPPPSLELLGAQLAERDYRQADET                    TRALLIELAGEPARRRGYVFFSEVQFISADDLRAIDALWQEHSGGRFGYSVQRRLWEK                    SRRDFTRFFIRVGWMKKLDTEVEQFNYRAFPDEFIWELNDDTPEGHLPLTNALRGTQL                    LGNIFTHPAFEEEQEDELAAEENDTPDNTGQSKDGSKGKERPKFMRDFFKPDYSF</aaseq>|
 
DNA = <dnaseqindica>224..1045#acaatccccttgacagcacagaggcaacagcaaaacacactctcatcagtgtcaggtctccacaccacacccaagtacaggtacacacaagacaatcctcccactgaactgaatcccatccactcctttatcatcatcaccatttccctccttcccttttcctcccctcatttccatttccagttgcagcaagagctgcctcctagctctcttcctgccatccatggcaaatgcttccctccaatcctttcttcttcaccaccaccattctttccttagcaatggtatccatgagggctcctccccttctataattctcaagctcacaacaaacagcaacagcagcatttcattcaagctcttctccaacaccacctcctcctcatcatcatcagtgaccaccacagcatcaacccccaactcaccggtgacccctgctccggtaacagcctcgtctccgccaccgccttcgctggagctcctgggcgcccagctcgccgagagggattaccggcaggccgacgagaccacccgcgcgctcctcatcgagctcgcgggcgagccagctcggcgccgagggtacgtcttcttctcggaggtgcagttcatctccgccgatgacctccgggccatcgacgcgctctggcaggagcacagcggtggccggttcgggtacagcgtgcagcggcggctgtgggagaagtcgcggcgcgacttcacccgcttcttcatcagggttgggtggatgaagaagcttgacaccgaggtggagcagttcaactacagggccttccctgatgagttcatctgggagctgaatgatgacacgccagaggggcatctccctctcaccaatgccctcagagggacacagctcctgggcaacatcttcacacatcctgcctttgaagaggagcaagaagatgaattagcagcagaggagaatgacacacctgataacactggtcagagtaaggatggcagcaaagggaaggagaggccaaagttcatgagagatttcttcaagcctgactactccttttgagattggggggtaattaaaaagcatgggagtttgtgatgcagagatgctggtcatggtgcaattgatttagaaaaaaaaaaaaaggaaacatgtatccgtagttcatctggattgttatgtcctgtaaacatgcgtgggaaactgcacaatatattatgaatataattgtttgagatgtttgctctgc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001074200.1 RefSeq:Os11g0267000]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 11]]
 
[[Category:Chromosome 11]]
 

Latest revision as of 06:11, 3 October 2016

The rice Os11g0267000 was reported as OsGUN4 (genomes uncoupled 4) in 2014 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os11g0267000 <=> OsGUN4

Function

  • For easy testing and to increase varietal purity, a xantha mutation (xnt), which turns plants yellow and makes them visually distinguishable from normal green rice, has been generated and bred into male sterile lines for hybrid rice production.
  • we have identified an epi-allele of OsGUN4 as the causal gene of the xantha marker trait and revealed that enhanced methylation in its promoter down-regulated its expression in rice.


Figure 2. Analysis of the rice GUN4 gene and its mutations. a Schematic diagram of the OsGUN4 locus.[1].

Expression

  • The expression of OsGUN4 was significantly reduced in HYB compared with LTB in terms of both transcript abundance (0.2 % that of LTB) and expressed protein level (barely detectable in HYB but greater than the heat shock protein reference in LTB).

Labs working on this gene

  • National Key Laboratory of Rice Biology, Institute of Crop Sciences, Zhejiang University, 310029 Hangzhou, China
  • Jiaxing Academy of Agricultural Sciences, 314016 Jiaxing, Zhejiang, China
  • College of Life Science, Hebei Agricultural University, 071001 Baoding, China

References

  1. 1.0 1.1 Li RQ, Huang JZ, Zhao HJ, Fu HW, Li YF, Liu GZ, Shu QY. A down-regulated epi-allele of the genomes uncoupled 4 gene generates a xantha marker trait in rice. Theor Appl Genet. 2014 Nov;127(11):2491-501. doi:10.1007/s00122-014-2393-9. Epub 2014 Sep 11. PubMed PMID: 25208645.


Structured Information