Difference between revisions of "Os02g0187800"

From RiceWiki
Jump to: navigation, search
(References)
 
(12 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os02g0187800''''' was reported as '''''GH2''''' in 2006 <ref name="ref1" /> and 2014 <ref name="ref2" /> by researchers from China and Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os02g0187800''''' '''''<=>''''' '''''OsGH2''''','''''CAD2''''','''''GH2''''','''''OsCAD2'''''
 +
[[File:Os02g0187800_1.png|right|thumb|327px|'''Figure 2.''' ''Phenotype of wild type and gh2 mutant.<ref name="ref1" />.'']]
 +
 
===Function===
 
===Function===
Please input function information here.
+
* Rice (Oryza sativa) gold hull and internode phenotype is a classical morphological marker trait that has long been applied to breeding and genetics study.
 +
* ''gh2'' mutant is a lignin-deficient mutant, and GH2 encodes a cinnamyl-alcohol dehydrogenase (CAD).
 +
* '''''OsGH2''''' acts as a primarily multifunctional CAD to synthesize coniferyl and sinapyl alcohol precursors in rice lignin biosynthesis.
 +
===Phenotypic analysis===
 +
* gh2 exhibits an obvious reddish-brown pigment in the panicle (hull), internode, and basal leaf sheath at the heading stage (Fig. 1, A and B). The reddish-brown pigments gradually become intensive starting from the basal internode to the apical internode. During plant maturing, seed coloration becomes darker and finally changes to golden yellow at maturation.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* Since the mutation is a point mutation, GH2 gene expression was detected in the wild-type plants only at the heading stage. Researchers detected GH2 gene transcription in all seven tissues, including panicles, hulls, blades, midribs, leaf sheaths, internodes, and young roots.
 +
* GH2 gene was expressed in the lignified tissues, including panicles, hulls, internodes, young roots, and leaf sheaths.
 +
* In the leaves (blade and midrib), which are slightly lignified, the GH2 transcripts cannot be obviously detected by northern blot.
 +
* Furthermore, GH2 gene expressed stronger in the first internode than in the second internode, suggesting that the gene ex- pressed gradually stronger starting from the basal internode to the apical internode (data not shown).
 +
* Consequently, the GH2 expression pattern is closely related to the rice lignification pattern and the local- ization of reddish-brown pigments.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* To determine the evolutionary relationship between GH2 and CAD family members from the rice and Arabidopsis CAD families as well as other representative identified CAD homologs, an unrooted tree was built using the neighbor-joining method based on full-length protein sequences (Fig. 3).
 +
* All the CAD protein sequences are divided into two subfamilies: subA (GH2, sugarcane [Saccharum officinarum] CAD, maize CAD, aspen PtCAD, eucalyptus [Eucalyptus globules] CAD, tobacco [Nicotiana tabacum] CAD1, tobacco CAD2, Lucerne [Medicago sativa] MsaCad2, Arabidopsis CADC, Arabidopsis CADD, pine [Pinus taeda] CAD, and spruce [Picea abies] CAD) and subB (Lucerne MsaCad1,aspen PtSAD, OsCAD1, OsCAD3, OsCAD4, OsCAD5,OsCAD6, OsCAD7, OsCAD8A-D, OsCAD9, AtCAD1, AtCAD2, AtCAD3, AtCAD6, AtCAD7, AtCAD8, and AtCAD9).
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101 People’s Republic of China
 +
* State Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou 310006, People’s Republic of China
 +
* Department of Agronomy, Yangzhou University, Yangzhou 225009, People’s Republic of China
 +
* Graduate School of the Chinese Academy of Sciences, Beijing 100049, People’s Republic of China
 +
* Institute of Agriculture, Graduate School, Tokyo University of Agriculture and Technology, Fuchu, Tokyo 183-8509, Japan
 +
* Bioscience and Biotechnology Center, Nagoya University, Nagoya, Aichi 464-8601, Japan
 +
* Agricultural Research Institute,Toyama Agricultural, Forestry & Fisheries Research Center, Toyama, Toyama 939-8153, Japan
 +
* Agrogenomics Research Center, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan
 +
* Institute of Radiation Breeding, National Institute of Agrobiological Sciences, Hitachiohmiya, Ibaraki 319-2293, Japan.
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Zhang K, Qian Q, Huang Z, Wang Y, Li M, Hong L, Zeng D, Gu M, Chu C, Cheng Z. GOLD HULL AND INTERNODE2 encodes a primarily multifunctional cinnamyl-alcohol dehydrogenase in rice. Plant Physiol. 2006 Mar;140(3):972-83. Epub 2006 Jan 27. PubMed PMID: 16443696; PubMed Central PMCID: PMC1400561.
 +
</ref>
 +
 
 +
* <ref name="ref2">
 +
Ookawa T, Inoue K, Matsuoka M, Ebitani T, Takarada T, Yamamoto T, Ueda T, Yokoyama T, Sugiyama C, Nakaba S, Funada R, Kato H, Kanekatsu M, Toyota K, Motobayashi T, Vazirzanjani M, Tojo S, Hirasawa T. Increased lodging resistance in long-culm, low-lignin gh2 rice for improved feed and bioenergy production. Sci Rep. 2014 Oct 9;4:6567. doi: 10.1038/srep06567. PubMed PMID: 25298209; PubMed Central PMCID: PMC4190510.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
GeneName = Os02g0187800|
 
Description = Cinnamyl alcohol dehydrogenase (EC 1.1.1.195)|
 
Version = NM_001052667.1 GI:115444704 GeneID:4328552|
 
Length = 3888 bp|
 
Definition = Oryza sativa Japonica Group Os02g0187800, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:4870148..4874035|
 
CDS = 4870315..4870975,4872018..4872245,4872874..4872987,4873813..4873901|
 
GCID = <gbrowseImage1>
 
name=NC_008395:4870148..4874035
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:4870148..4874035
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgggcagcctcgccgccgagaagaccgtcaccgggtgggccgccagggacgcctccggccacctcaccccctacaactacaccctcaggaagactgggcctgaagatgtggtggtgaaggttttgtattgtggtatctgccatactgacatccaccaggccaagaaccaccttggtgcttccaagtaccccatggtccctggccatgaggtggtcggcgaggtggtggaggtcgggccggaggtgaccaagtacagcgccggcgacgtcgtcggcgtcggcgtcatcgtcggctgctgccgcgagtgccatccgtgcaaggccaatgtggagcagtactgcaacaagaggatttggtcctacaacgacgtctacaccgacggccggccaacccagggcggcttcgcctccgccatggtcgtcgaccagaagtttgtggtgaagatcccggcggggctagcgccggagcaggcggcgccgctgctgtgcgccgggctgacggtgtacagcccactgaagcacttcgggctgatgtcgccaggtctccgcggcggcgtcctggggctcggcggcgtggggcacatgggcgtgaaggtggccaagtcgatggggcaccacgtgacggtgatcagctcgtcggcgaggaagcgcggcgaggccatggacgacctgggcgccgacgcctacctcgtcagctccgacgcggcggcgatggcggccgccggcgactcgctggactacatcatcgacaccgtgccggtgcaccacccgctggagccgtacctggcgctgctgaagctggacgggaagctgatcctgatgggggtgatcaaccagccgctgagcttcatctcgcccatggtgatgctcggccggaaggccatcaccggcagcttcatcgggagcatggccgagacggaggaggtgctcaacttctgcgtcgacaaggggctcacctcccagatcgaggtcgtcaagatggactacgtcaaccaggccctcgagcgcctcgagcgcaacgacgtccgctaccgcttcgtcgtcgacgtcgccggcagcaacatcgacgacgccgacgcgccgcccgcctga</cdnaseq>|
 
AA = <aaseq>MGSLAAEKTVTGWAARDASGHLTPYNYTLRKTGPEDVVVKVLYC                    GICHTDIHQAKNHLGASKYPMVPGHEVVGEVVEVGPEVTKYSAGDVVGVGVIVGCCRE                    CHPCKANVEQYCNKRIWSYNDVYTDGRPTQGGFASAMVVDQKFVVKIPAGLAPEQAAP                    LLCAGLTVYSPLKHFGLMSPGLRGGVLGLGGVGHMGVKVAKSMGHHVTVISSSARKRG                    EAMDDLGADAYLVSSDAAAMAAAGDSLDYIIDTVPVHHPLEPYLALLKLDGKLILMGV                    INQPLSFISPMVMLGRKAITGSFIGSMAETEEVLNFCVDKGLTSQIEVVKMDYVNQAL                    ERLERNDVRYRFVVDVAGSNIDDADAPPA</aaseq>|
 
DNA = <dnaseqindica>3061..3721#1791..2018#1049..1162#135..223#agaattcagcgagagagagcgaatcagccactgcacttcttgttcttgttctcttcctcctcccgaatccgatccatccattggccgccgccgccgccgccgcctcgtgcgtcgcgtgttcgtgtccagagacgatgggcagcctcgccgccgagaagaccgtcaccgggtgggccgccagggacgcctccggccacctcaccccctacaactacaccctcaggtatgatatgatatgatcgatcaccctctccttctcgatcttgttcttgcaagttttgcttaaggtcggtagaaacggagggattaggttttagtttctcttttgtctcaattctgaaactctggtacatgcgttctactacagtttagttgttcagatggttcgtttctgaatttctgaaaactgatggcgttccagtgctttagttgtttagatgcccccgtgttttaatttgtttgtgttcatgtcatctgcctcgagtacaactcagattgtttctgcctcttggccaaagtgtgaagaggtgaagagagcaattggatttcttttttcttttttgggctcctccattcgatccattccacacttcccacgtgagtttgactctattttgtattcctgctcctctcctagtataagtccaacatgaagagtatagtggtgtagtactagtgtactaccaaaactgcttcacctaccgccaattggctattgcaatcatcgtcacgtcttggttttgttgggtgaaaggaacagaatccctgaatccggagcagttgtggcaaacagacagaatgcatggagttctttttggctagttgcctggctccacatatatatattttcagaagcattctttataattttctaatatatatatttgctatgcaattctcgtgccatgcctccttaaagaaaaggaggattatatatatatcaataatttccttgagttgtcttcttgtagaatggaataactgaagaagcatcttatgcaacagatcaactaatgttctttttttttcctgtatgtggtggtaccaggaagactgggcctgaagatgtggtggtgaaggttttgtattgtggtatctgccatactgacatccaccaggccaagaaccaccttggtgcttccaagtaccccatggtccctgggtaagattattcacagttatctagatggatcatggctcatgtcaatggagatcttctactagcaattgatttgatggtgtattctatagtagactgaagataaacttattaactgattgggataacaaacatatcagaaaagagtaggcactagtaactagcaaatctggtcagtgcttttttcagatttacaaaaggcatagatgcacatgcaccactatatcacactcctttggaacagaaagataagttagtgcatcgcttttagcatttttcttttttgatcaacacctttcatgacaggtatagtacagattagatgcaccatcagtttcagagacacgtgtaaagaaaacctcagcgagaaccttccctgatctgatgggctttaaataagcacacgatagatccccaacaccaggctgaaaaatgatgcctaattagtagtaatttagtactactacaccatctgcatgtcgtactaagtatgcaacaataattggttggattaattagttggtgaccaagaattcctttttccagtacacttccattgtcgtaccaatattcagtcatgtgttggattttgtcggtgaccaagaaaattctctcctcttctcgtctgcagccatgaggtggtcggcgaggtggtggaggtcgggccggaggtgaccaagtacagcgccggcgacgtcgtcggcgtcggcgtcatcgtcggctgctgccgcgagtgccatccgtgcaaggccaatgtggagcagtactgcaacaagaggatttggtcctacaacgacgtctacaccgacggccggccaacccagggcggcttcgcctccgccatggtcgtcgaccagaagtgagtgctaaacacagctttactccaacaagtaatcaccaaccaactgatcacgatatcattatcatattatcatattgtcagtgttctaggtagagaaaactagactggacttttccgaacatccaaagtaaagtccagtctgttagaaaattttgtggagaaaatgtcatctgagactgaaagagatgtcgagaagtcggtactgtgttgagtgtaaagtgagaagtcaccaaagttaggtataaagtgttgattaactgataagtcctcacctaccccggtccattagtccatttgttgttggaagaattgcttcttgaacagagcaaaagttggattgttgcatagcgtcgttgtagtcagttggtaaactagcagagacagtgaaatgttgggctcattttgtttggtgcgctaccaaatcattggtagcgtcaaatcatggtcaagatttggcactaccaatattttagtatagttggtttataagagcaagttcaatagtaaagttaactgccggctccaaaattcaccacattatttaagagataactaaacaatggtagatacagtaattggctacacccatgctttaaccaaggcatcctgtcaggtgttggtaacttctgcatgttcaagttctaattttcgattggttgtcccgagctgcagggggccagagcgcctaggcgctcgtgcttgagccggtgactggattgtcgtccgctttgctctctctgctttccctctctctatcatatatgttaaaatattaggtaagcaggctattagcctgctattgtacctgctctaagagttgtattacctttggtaaattttgacatcattacaaacatatacatggtactatttaaagtgccaactatttgatagggcaaattctggcatcaaaccaaaacatcccgtgatttttgatccacctgcctaatctgaaagttgtcacgtcttaaaaagattaaaatatttggttagtgagatggtaagaaactagtaaaaaaagtaatgaatttgtgtgcaggtttgtggtgaagatcccggcggggctagcgccggagcaggcggcgccgctgctgtgcgccgggctgacggtgtacagcccactgaagcacttcgggctgatgtcgccaggtctccgcggcggcgtcctggggctcggcggcgtggggcacatgggcgtgaaggtggccaagtcgatggggcaccacgtgacggtgatcagctcgtcggcgaggaagcgcggcgaggccatggacgacctgggcgccgacgcctacctcgtcagctccgacgcggcggcgatggcggccgccggcgactcgctggactacatcatcgacaccgtgccggtgcaccacccgctggagccgtacctggcgctgctgaagctggacgggaagctgatcctgatgggggtgatcaaccagccgctgagcttcatctcgcccatggtgatgctcggccggaaggccatcaccggcagcttcatcgggagcatggccgagacggaggaggtgctcaacttctgcgtcgacaaggggctcacctcccagatcgaggtcgtcaagatggactacgtcaaccaggccctcgagcgcctcgagcgcaacgacgtccgctaccgcttcgtcgtcgacgtcgccggcagcaacatcgacgacgccgacgcgccgcccgcctgatcgccgccgtgcaccctcatggcagcatccgtatgatccgttcttgaacttgtttgtgtgagactctgacgacttgtccatgtaacgtccgtgtgcctttccggtataaattcggcctcgcaatatatggaccattttgcatttccgatcaaaatcatgcttgcgtt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052667.1 RefSeq:Os02g0187800]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 07:40, 3 October 2016

The rice Os02g0187800 was reported as GH2 in 2006 [1] and 2014 [2] by researchers from China and Japan.

Annotated Information

Gene Symbol

  • Os02g0187800 <=> OsGH2,CAD2,GH2,OsCAD2
Figure 2. Phenotype of wild type and gh2 mutant.[1].

Function

  • Rice (Oryza sativa) gold hull and internode phenotype is a classical morphological marker trait that has long been applied to breeding and genetics study.
  • gh2 mutant is a lignin-deficient mutant, and GH2 encodes a cinnamyl-alcohol dehydrogenase (CAD).
  • OsGH2 acts as a primarily multifunctional CAD to synthesize coniferyl and sinapyl alcohol precursors in rice lignin biosynthesis.

Phenotypic analysis

  • gh2 exhibits an obvious reddish-brown pigment in the panicle (hull), internode, and basal leaf sheath at the heading stage (Fig. 1, A and B). The reddish-brown pigments gradually become intensive starting from the basal internode to the apical internode. During plant maturing, seed coloration becomes darker and finally changes to golden yellow at maturation.

Expression

  • Since the mutation is a point mutation, GH2 gene expression was detected in the wild-type plants only at the heading stage. Researchers detected GH2 gene transcription in all seven tissues, including panicles, hulls, blades, midribs, leaf sheaths, internodes, and young roots.
  • GH2 gene was expressed in the lignified tissues, including panicles, hulls, internodes, young roots, and leaf sheaths.
  • In the leaves (blade and midrib), which are slightly lignified, the GH2 transcripts cannot be obviously detected by northern blot.
  • Furthermore, GH2 gene expressed stronger in the first internode than in the second internode, suggesting that the gene ex- pressed gradually stronger starting from the basal internode to the apical internode (data not shown).
  • Consequently, the GH2 expression pattern is closely related to the rice lignification pattern and the local- ization of reddish-brown pigments.

Evolution

  • To determine the evolutionary relationship between GH2 and CAD family members from the rice and Arabidopsis CAD families as well as other representative identified CAD homologs, an unrooted tree was built using the neighbor-joining method based on full-length protein sequences (Fig. 3).
  • All the CAD protein sequences are divided into two subfamilies: subA (GH2, sugarcane [Saccharum officinarum] CAD, maize CAD, aspen PtCAD, eucalyptus [Eucalyptus globules] CAD, tobacco [Nicotiana tabacum] CAD1, tobacco CAD2, Lucerne [Medicago sativa] MsaCad2, Arabidopsis CADC, Arabidopsis CADD, pine [Pinus taeda] CAD, and spruce [Picea abies] CAD) and subB (Lucerne MsaCad1,aspen PtSAD, OsCAD1, OsCAD3, OsCAD4, OsCAD5,OsCAD6, OsCAD7, OsCAD8A-D, OsCAD9, AtCAD1, AtCAD2, AtCAD3, AtCAD6, AtCAD7, AtCAD8, and AtCAD9).

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101 People’s Republic of China
  • State Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou 310006, People’s Republic of China
  • Department of Agronomy, Yangzhou University, Yangzhou 225009, People’s Republic of China
  • Graduate School of the Chinese Academy of Sciences, Beijing 100049, People’s Republic of China
  • Institute of Agriculture, Graduate School, Tokyo University of Agriculture and Technology, Fuchu, Tokyo 183-8509, Japan
  • Bioscience and Biotechnology Center, Nagoya University, Nagoya, Aichi 464-8601, Japan
  • Agricultural Research Institute,Toyama Agricultural, Forestry & Fisheries Research Center, Toyama, Toyama 939-8153, Japan
  • Agrogenomics Research Center, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan
  • Institute of Radiation Breeding, National Institute of Agrobiological Sciences, Hitachiohmiya, Ibaraki 319-2293, Japan.

References

  1. 1.0 1.1 Zhang K, Qian Q, Huang Z, Wang Y, Li M, Hong L, Zeng D, Gu M, Chu C, Cheng Z. GOLD HULL AND INTERNODE2 encodes a primarily multifunctional cinnamyl-alcohol dehydrogenase in rice. Plant Physiol. 2006 Mar;140(3):972-83. Epub 2006 Jan 27. PubMed PMID: 16443696; PubMed Central PMCID: PMC1400561.
  2. Ookawa T, Inoue K, Matsuoka M, Ebitani T, Takarada T, Yamamoto T, Ueda T, Yokoyama T, Sugiyama C, Nakaba S, Funada R, Kato H, Kanekatsu M, Toyota K, Motobayashi T, Vazirzanjani M, Tojo S, Hirasawa T. Increased lodging resistance in long-culm, low-lignin gh2 rice for improved feed and bioenergy production. Sci Rep. 2014 Oct 9;4:6567. doi: 10.1038/srep06567. PubMed PMID: 25298209; PubMed Central PMCID: PMC4190510.

Structured Information