Difference between revisions of "Os02g0649300"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os02g0649300| Description = Similar to Short highly repeated, interspersed DNA (Fragment)| Version = NM_001054117.1 GI:115447604 GeneID:4330155| ...")
 
(Annotated Information)
 
(18 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os02g0649300''''' was reported as '''''OsSLI1''''' in 2014 <ref name="ref1" /> by researchers from China.  
GeneName = Os02g0649300|
 
Description = Similar to Short highly repeated, interspersed DNA (Fragment)|
 
Version = NM_001054117.1 GI:115447604 GeneID:4330155|
 
Length = 1005 bp|
 
Definition = Oryza sativa Japonica Group Os02g0649300, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Gene Symbol===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
*'''''Os02g0649300''''' '''''<=>''''' '''''OsSLI1'''''
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
[[File:7-Os02g0649300-1.png|right|thumb|357px|'''Figure 6.''' ''Nuclear localization of OsSLI1-GFP fusion protein.<ref name="ref1" />.'']]
|
+
===Function===
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
+
* '''''OsSLI1''''' encodes member of the HD-Zip I subfamily
AP = Chromosome 2:27030180..27031184|
+
* '''''OsSLI1''''' may be a transcriptional activator regulating stress-responsive gene expression and panicle development in rice.
CDS = 27030272..27030730,27030818..27031144|
+
* It was found that OsSLI1 expression was enhanced in an ABI5-Like1 (ABL1) deficiency mutant abl1 under both normal and stress conditions, suggesting that ABL1 probably negatively regulates '''''OsSLI1''''' gene expression.
GCID = <gbrowseImage1>
+
 
name=NC_008395:27030180..27031184
+
===Expression===
source=RiceChromosome02
+
* Quantitative RT-PCR result showed that in the seedlings, '''''OsSLI1''''' expression was mainly in root.  
preset=GeneLocation
+
* The root tissue accumulates 7 times of '''''OsSLI1''''' transcripts than in shoot tissue.  
</gbrowseImage1>|
+
* In panicles, the expression changes in different development stages, from relative low in 3 cm young panicles to a 33-fold increase in 8 cm panicles, and the 12 cm panicles still accumulate 8-fold OsSLI1 transcripts compared to 3 cm young panicles tissue.
GSID = <gbrowseImage2>
+
* Quantitative RT-PCR assay showed that OsSLI1 expression was highly induced by salt, PEG, H2O2 , high temperature, and ABA treatment but not by cold treatment.
name=NC_008395:27030180..27031184
+
===Subcellular Localization===
source=RiceChromosome02
+
* '''''OsSLI1''''' is a nuclear-localized protein, in consistency with its potential function as a DNA binding transcription factor.
preset=GeneLocation
+
 
</gbrowseImage2>|
+
 
CDNA = <cdnaseq>atggagagcgactgccagttcttggtggcgccgccgcagccgcacatgtactacgacacggcggcggcggcggtggacgaggcgcagttcttgcggcagatggtggccgcggcggatcaccacgcggccgccgctgggagaggaggcggcgacggcgacggcggcggcggcggcggcggtggcggggagaggaagcggcggttcacggaggagcaggtgcggtcgctggagacgacgttccacgcgcggcgggccaagctggagccgcgggagaaggcggagctggcgcgggagctcgggctgcagccgcgccaggtggccatctggttccagaacaagcgcgcccggtggcgctccaagcagatcgagcacgactacgccgcgctccgcgcccagtacgacgccctccacgcccgcgtcgagtcgctcaggcaggagaagctcgccctcgcagaccaggtggatgagctgagggggaagctgaacgagcggcaagaccagagcggcagctgcgacggcggcggcgccgaaggggacgacgacgacaagaggaatagcgtgatgaacgcgagcagcagcggcctcgtggaggaggactacgtgagctgcctcgcggtgccggtggtggacgtctcggaggacggctcggcggcgtgcggcgggtcgtcgtacgagtacgaccatcacctagactacttgggcggcggccagctgcccgatccgttctgcggcatgccggatctgtgggagatatggccaatggtggaatggaacgcagtagcatga</cdnaseq>|
+
You can also add sub-section(s) at will.
AA = <aaseq>MESDCQFLVAPPQPHMYYDTAAAAVDEAQFLRQMVAAADHHAAA                    AGRGGGDGDGGGGGGGGGERKRRFTEEQVRSLETTFHARRAKLEPREKAELARELGLQ                    PRQVAIWFQNKRARWRSKQIEHDYAALRAQYDALHARVESLRQEKLALADQVDELRGK                    LNERQDQSGSCDGGGAEGDDDDKRNSVMNASSSGLVEEDYVSCLAVPVVDVSEDGSAA                    CGGSSYEYDHHLDYLGGGQLPDPFCGMPDLWEIWPMVEWNAVA</aaseq>|
+
 
DNA = <dnaseqindica>93..551#639..965#acactactgcgactgctagtgctctggtcttacattcgacgaactgatcgatattcgatacgacgtctcctcctacctggagcttgggaaaaatggagagcgactgccagttcttggtggcgccgccgcagccgcacatgtactacgacacggcggcggcggcggtggacgaggcgcagttcttgcggcagatggtggccgcggcggatcaccacgcggccgccgctgggagaggaggcggcgacggcgacggcggcggcggcggcggcggtggcggggagaggaagcggcggttcacggaggagcaggtgcggtcgctggagacgacgttccacgcgcggcgggccaagctggagccgcgggagaaggcggagctggcgcgggagctcgggctgcagccgcgccaggtggccatctggttccagaacaagcgcgcccggtggcgctccaagcagatcgagcacgactacgccgcgctccgcgcccagtacgacgccctccacgcccgcgtcgagtcgctcaggcaggagaagctcgccctcgcagaccaggttcgtgcgccattgccgaccaatcatcagctatacctgctgcatacgtgcacgcatggtgacaatgcgcgctttgccttcttgcaggtggatgagctgagggggaagctgaacgagcggcaagaccagagcggcagctgcgacggcggcggcgccgaaggggacgacgacgacaagaggaatagcgtgatgaacgcgagcagcagcggcctcgtggaggaggactacgtgagctgcctcgcggtgccggtggtggacgtctcggaggacggctcggcggcgtgcggcgggtcgtcgtacgagtacgaccatcacctagactacttgggcggcggccagctgcccgatccgttctgcggcatgccggatctgtgggagatatggccaatggtggaatggaacgcagtagcatgatcatgctaatcaatcagcgtagcatacagtatataaatat</dnaseqindica>|
+
==Labs working on this gene==
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054117.1 RefSeq:Os02g0649300]|
+
* State Key Laboratory of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing 210095, China
}}
+
 
[[Category:Genes]]
+
==References==
[[Category:Japonica mRNA]]
+
<references>
[[Category:Oryza Sativa Japonica Group]]
+
* <ref name="ref1">
[[Category:Japonica Genes]]
+
Huang X, Duan M, Liao J, Yuan X, Chen H, Feng J, Huang J, Zhang HS. OsSLI1, a  homeodomain containing transcription activator, involves abscisic acid related stress response in rice (Oryza sativa L.). ScientificWorldJournal. 2014;2014:809353. doi: 10.1155/2014/809353. Epub 2014 Jun 25. PubMed PMID: 25089296; PubMed Central PMCID: PMC4095735.
[[Category:Japonica Chromosome 2]]
+
</references>
[[Category:Chromosome 2]]
+
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]

Latest revision as of 11:34, 3 October 2016

The rice Os02g0649300 was reported as OsSLI1 in 2014 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os02g0649300 <=> OsSLI1
Figure 6. Nuclear localization of OsSLI1-GFP fusion protein.[1].

Function

  • OsSLI1 encodes member of the HD-Zip I subfamily
  • OsSLI1 may be a transcriptional activator regulating stress-responsive gene expression and panicle development in rice.
  • It was found that OsSLI1 expression was enhanced in an ABI5-Like1 (ABL1) deficiency mutant abl1 under both normal and stress conditions, suggesting that ABL1 probably negatively regulates OsSLI1 gene expression.

Expression

  • Quantitative RT-PCR result showed that in the seedlings, OsSLI1 expression was mainly in root.
  • The root tissue accumulates 7 times of OsSLI1 transcripts than in shoot tissue.
  • In panicles, the expression changes in different development stages, from relative low in 3 cm young panicles to a 33-fold increase in 8 cm panicles, and the 12 cm panicles still accumulate 8-fold OsSLI1 transcripts compared to 3 cm young panicles tissue.
  • Quantitative RT-PCR assay showed that OsSLI1 expression was highly induced by salt, PEG, H2O2 , high temperature, and ABA treatment but not by cold treatment.

Subcellular Localization

  • OsSLI1 is a nuclear-localized protein, in consistency with its potential function as a DNA binding transcription factor.


You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing 210095, China

References

  1. 1.0 1.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref1

Structured Information