Difference between revisions of "Os07g0604700"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os07g0604700| Description = B12D family protein| Version = NM_001066758.2 GI:297607590 GeneID:4343848| Length = 991 bp| Definition = Oryza sati...")
 
(References)
 
(12 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os07g0604700''''' was reported as '''''OsB12D1''''' in 2014 <ref name="ref1" /> by researchers from China.  
GeneName = Os07g0604700|
 
Description = B12D family protein|
 
Version = NM_001066758.2 GI:297607590 GeneID:4343848|
 
Length = 991 bp|
 
Definition = Oryza sativa Japonica Group Os07g0604700, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Gene Symbol===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
*'''''Os07g0604700''''' '''''<=>''''' '''''OsB12D1'''''
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
===Function===
|
+
* '''''OsB12D1''''' pertains to an ancient protein family with an amino acid sequence highly conserved from moss to angiosperms;
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
+
* '''''OsB12D1''''' is an anoxic or submergence resistance-related gene;
AP = Chromosome 7:25428232..25429222|
+
* '''''OsB12D1''''' is a promising gene that can help to enhance rice seedling establishment in farming practices, especially for direct seeding.
CDS = 25428363..25428386,25428771..25429034|
+
* Overexpression of '''''OsB12D1''''' enhanced rice seed flooding tolerance.
GCID = <gbrowseImage1>
+
 
name=NC_008400:25428232..25429222
+
===Expression===
source=RiceChromosome07
+
* RT-PCR results showed '''''OsB12D1''''' is induced remarkably in the coleoptiles or roots by flooding during seed germination and early seedling growth.
preset=GeneLocation
+
* '''''OsB12D1''''' is one of the major transcripts and is primarily expressed in germinating seed and root.
</gbrowseImage1>|
+
* The digital expression patterns indicated the OsB12Ds were highly expressed in germinating seed and low in dry seeds, stems and leaves.
GSID = <gbrowseImage2>
+
 
name=NC_008400:25428232..25429222
+
===Subcellular localization===
source=RiceChromosome07
+
* A construct of p35S-OsB12D1-gfp was introduced into the transient expression system of the Arabidopsis protoplast to investigate the subcellular localization of OsB12D1. The florescence signal of OsB12D1-GFP was observed to well match the RFP signal of MitoTracker Red but not overlap the chlorophyll (Figure 5A), which indicated that the '''''OsB12D1 is mainly located in the mitochondrion.'''''
preset=GeneLocation
+
 
</gbrowseImage2>|
+
 
CDNA = <cdnaseq>atgggccgttgggtgaagccagatgtatacccgctgatcgtggcgatgtctctggtgggagggatgtgcgtgttccagctgacgaggaacgtgttcatgaacccggacgtgagggtgaacaagagccaccgccagagcgccgtgctggagaacgccgacgagggggagaagtatcaccaccacgccttccgccgattcctcggcacgcagcgccccgaggtcttcccggcgatcaaccgcttcttcgccggcccggccaccgtccccaagagtgaccgtcaaaactga</cdnaseq>|
+
[[File:Os07g0604700.png|center|thumb|800px|'''Figure 2.''' ''qRT-PCR analysis of the OsB12Ds expressional pattern in different stages of rice seed germination and various tissues.<ref name="ref1" />.'']]
AA = <aaseq>MGRWVKPDVYPLIVAMSLVGGMCVFQLTRNVFMNPDVRVNKSHR                    QSAVLENADEGEKYHHHAFRRFLGTQRPEVFPAINRFFAGPATVPKSDRQN</aaseq>|
+
 
DNA = <dnaseqindica>132..155#540..803#attgtgcatcgagttccagcccagatttcttcagtttcaaggcttcgatctatcggatcattcgttgcagtcctagcaagaaacaaaaacagcagcagcgtcaggcagacgaggatcatccatcgatcgacatgggccgttgggtgaagccagatgtacgtatcaattattcgatgatatatactccctccatctttaaatgtttgacgccgttaattttttaaacatgtttgatcgttcgtcttatttaaaaaatttaagtaatcattaatttttttcttatcatttgtttcatcgataaatatacttttatgtgtacatatagttttacatattttacaaaagtttttggataagatggatgatcaaacatatttaaaaaaattaacgttgtcaaatatttagagacgaagggagtaactaattacatacatttcctcttgattaactattcgatttgtagatagacagatgcagcagaatcaaagggtgttagttttaaagtttgatacgatgtttttttttttttgatgatgcaggtatacccgctgatcgtggcgatgtctctggtgggagggatgtgcgtgttccagctgacgaggaacgtgttcatgaacccggacgtgagggtgaacaagagccaccgccagagcgccgtgctggagaacgccgacgagggggagaagtatcaccaccacgccttccgccgattcctcggcacgcagcgccccgaggtcttcccggcgatcaaccgcttcttcgccggcccggccaccgtccccaagagtgaccgtcaaaactgatcctccaaatgcttattagccgctatatagtaatgtactcctatattaattatagccaaatgagaggctgattatagtgctatacacgggtactttaattactgagttttgttactggatatgtgtcgcatacgtgcgaacttaatcgtatctgaataaaatgagataaaaatgaagaaatggcacct</dnaseqindica>|
+
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001066758.2 RefSeq:Os07g0604700]|
+
 
}}
+
 
[[Category:Genes]]
+
You can also add sub-section(s) at will.
[[Category:Japonica mRNA]]
+
 
[[Category:Oryza Sativa Japonica Group]]
+
==Labs working on this gene==
[[Category:Japonica Genes]]
+
* Key Laboratory of Plant Germplasm Enhancement and Specialty Agriculture, Wuhan Botanical Garden, Chinese Academy of Sciences, Wuhan 430074, China;
[[Category:Japonica Chromosome 7]]
+
* Graduate University of Chinese Academy of Sciences, Beijing 100049, China;
[[Category:Chromosome 7]]
+
 
 +
==References==
 +
<references>
 +
* <ref name="ref1">
 +
He, Dongli, Hui Zhang, and Pingfang Yang. "The Mitochondrion-Located Protein OsB12D1 Enhances Flooding Tolerance during Seed Germination and Early Seedling Growth in Rice." International journal of molecular sciences 15.8 (2014): 13461-13481.
 +
</ref>
 +
 
 +
</references>
 +
 
 +
==Structured Information==
 +
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 7]]

Latest revision as of 03:12, 8 October 2016

The rice Os07g0604700 was reported as OsB12D1 in 2014 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os07g0604700 <=> OsB12D1

Function

  • OsB12D1 pertains to an ancient protein family with an amino acid sequence highly conserved from moss to angiosperms;
  • OsB12D1 is an anoxic or submergence resistance-related gene;
  • OsB12D1 is a promising gene that can help to enhance rice seedling establishment in farming practices, especially for direct seeding.
  • Overexpression of OsB12D1 enhanced rice seed flooding tolerance.

Expression

  • RT-PCR results showed OsB12D1 is induced remarkably in the coleoptiles or roots by flooding during seed germination and early seedling growth.
  • OsB12D1 is one of the major transcripts and is primarily expressed in germinating seed and root.
  • The digital expression patterns indicated the OsB12Ds were highly expressed in germinating seed and low in dry seeds, stems and leaves.

Subcellular localization

  • A construct of p35S-OsB12D1-gfp was introduced into the transient expression system of the Arabidopsis protoplast to investigate the subcellular localization of OsB12D1. The florescence signal of OsB12D1-GFP was observed to well match the RFP signal of MitoTracker Red but not overlap the chlorophyll (Figure 5A), which indicated that the OsB12D1 is mainly located in the mitochondrion.


Figure 2. qRT-PCR analysis of the OsB12Ds expressional pattern in different stages of rice seed germination and various tissues.[1].



You can also add sub-section(s) at will.

Labs working on this gene

  • Key Laboratory of Plant Germplasm Enhancement and Specialty Agriculture, Wuhan Botanical Garden, Chinese Academy of Sciences, Wuhan 430074, China;
  • Graduate University of Chinese Academy of Sciences, Beijing 100049, China;

References

  1. 1.0 1.1 He, Dongli, Hui Zhang, and Pingfang Yang. "The Mitochondrion-Located Protein OsB12D1 Enhances Flooding Tolerance during Seed Germination and Early Seedling Growth in Rice." International journal of molecular sciences 15.8 (2014): 13461-13481.

Structured Information