Difference between revisions of "Os04g0692600"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os04g0692600| Description = Conserved hypothetical protein| Version = NM_001060905.1 GI:115461539 GeneID:4337516| Length = 1629 bp| Definition ...")
 
(Annotated Information)
 
(5 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os04g0692600''''' was reported as '''''SGRL ''''' in 2013 <ref name="ref1" /> by researchers from Portugal.  
GeneName = Os04g0692600|
 
Description = Conserved hypothetical protein|
 
Version = NM_001060905.1 GI:115461539 GeneID:4337516|
 
Length = 1629 bp|
 
Definition = Oryza sativa Japonica Group Os04g0692600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
[[File:Os04g0692600.png|right|thumb|327px|'''Figure 3.''' ''Analysis of SGRL and SGR expression by quantitative real-time PCR.<ref name="ref1" />.'']]
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
===Gene Symbol===
|
+
*'''''Os04g0692600''''' '''<=>''' '''''OsSGRL,SGRL'''''
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
+
===Function===
AP = Chromosome 4:35843781..35845409|
+
* Overexpression of '''''SGRL''''' reduces the levels of Chl and Chl-binding proteins in leaves, and accelerates their degradation in dark-induced senescence leaves in rice.
CDS = 35843967..35844131,35844454..35844783,35844883..35845036,35845132..35845259|
+
* '''''SGRL''''' protein is involved in Chl degradation.
GCID = <gbrowseImage1>
+
 
name=NC_008397:35843781..35845409
+
===Expression===
source=RiceChromosome04
+
* Real-time Fluorescence Quantitative PCR analysis was used to investigate the patterns of SRGL expression in six tissues from rice plants: roots, stems, young leaves, senescent leaves, panicles and seeds. SGRL was strongly expressed in green tissues (leaves, stems and panicles), but less in nonphotosynthetic tissues (roots and seeds)
preset=GeneLocation
+
* The SGRL gene was strongly expressed during the transition from dark to light, but was less strongly expressed during the day. Conversely, SGR expression increased during the light period and peaked at noon.
</gbrowseImage1>|
+
 
GSID = <gbrowseImage2>
+
===Evolution===
name=NC_008397:35843781..35845409
+
* The SGR and SGRL proteins share a highly conserved central region consisting of approximately 120 amino acid residues, but differ at both the N- and C-termini.
source=RiceChromosome04
+
 
preset=GeneLocation
+
You can also add sub-section(s) at will.
</gbrowseImage2>|
+
 
CDNA = <cdnaseq>atgccaatagaagctgtggcggtcgcttctttaccgatggcgtcgcgcagcgccgccctgtgcttctcctccgccgccgctgcccggagccggagcaggagccggcacggcaggatggccgtcagctgcgacgccggggcctcagatctgctctattcctctctggctgccaagctgcttggccctcccaccagcttcgatgccggcaagctgacggtagagttcgcccacagccacgggaacagcagctccgggttccccagagcttacaccctcacccactgcgacttcaccgctaacctcaccctcgccgtctccgacaccatcgccgccgaccgccgcctcagggcggacgacgtcttcgccgagtggaagcagcagcaacagcaggagggcatggccctgcacgtgcactgcttcgtcagcggcgccaacctcctgcatggcctcgccgccggcttcaggtactacgtcttctccaaggagctgccgctggttctcaaggcagttgttcatggcgacgcattgctgttcgcggagcagccggagctgctggaggcgaaggtgtgggtgcacttccactccagctccaacgctaagtacaacaggctcgagtgctggggtcctctcagggaggctgcaaacgccgagacgacgcacaagaggcatgcgctggagcaactgcacaacgcaatcaccaaaggcacaagaaggcgtaggaggaagtggtctagcccggacgccatcttcagcgccctgctcgcccttctcctttga</cdnaseq>|
+
==Labs working on this gene==
AA = <aaseq>MPIEAVAVASLPMASRSAALCFSSAAAARSRSRSRHGRMAVSCD                    AGASDLLYSSLAAKLLGPPTSFDAGKLTVEFAHSHGNSSSGFPRAYTLTHCDFTANLT                    LAVSDTIAADRRLRADDVFAEWKQQQQQEGMALHVHCFVSGANLLHGLAAGFRYYVFS                    KELPLVLKAVVHGDALLFAEQPELLEAKVWVHFHSSSNAKYNRLECWGPLREAANAET                    THKRHALEQLHNAITKGTRRRRRKWSSPDAIFSALLALLL</aaseq>|
+
* Key Laboratory of Plant Resources Conservation and Sustainable Utilization, South China Botanical Garden, Chinese Academy of Sciences, Guangzhou 510650, PR China
DNA = <dnaseqindica>187..351#674..1003#1103..1256#1352..1479#gctgctcttcatccgattcaactcggaccaccagatttcttccttccttccttgcagaatctttcattgttcttgttgggaggaaggagacgaggcgcgcgaggcggcgagagggaggaggcattctagcatatacagatacagagccaggggaggtatggaggagggccttgcacgagcacgacgatgccaatagaagctgtggcggtcgcttctttaccgatggcgtcgcgcagcgccgccctgtgcttctcctccgccgccgctgcccggagccggagcaggagccggcacggcaggatggccgtcagctgcgacgccggggcctcagatctgctctattcctctctggtactacgttgtactccatccgtttcaaaatgtttgacacatttaactttttagcacgtgtttgaccattcgttttatttaaaaaaaattaattaattatttattcttttcatatcatttgattcattgttaagtacacgtatagttttacatatttcacaattttttttaataagacgaacggtgttaaaaagtcaacggtgtcaaacattttaaaacggatggagtcctagtatattatctctgtctcaataattaggatactaattaattcatgtgtcgctgataaccttctgaatgaatgttattgttatgaggcaaggctgccaagctgcttggccctcccaccagcttcgatgccggcaagctgacggtagagttcgcccacagccacgggaacagcagctccgggttccccagagcttacaccctcacccactgcgacttcaccgctaacctcaccctcgccgtctccgacaccatcgccgccgaccgccgcctcagggcggacgacgtcttcgccgagtggaagcagcagcaacagcaggagggcatggccctgcacgtgcactgcttcgtcagcggcgccaacctcctgcatggcctcgccgccggcttcaggtactacgtcttctccaaggagctgccgctggtaagcaattatatatcgatattttgtactactattacagtagtagtagtagtagtagcaattaggaaggtgaaatcaactatgataagctgaatgcaggttctcaaggcagttgttcatggcgacgcattgctgttcgcggagcagccggagctgctggaggcgaaggtgtgggtgcacttccactccagctccaacgctaagtacaacaggctcgagtgctggggtcctctcagggaggctgcaaacgccgaggcatgccttccttctctcttcccgaattgcaaattgcaaatgcaaatacctgctagctgaactcaatgcaaattccaaatgctttgcgtttgcagacgacgcacaagaggcatgcgctggagcaactgcacaacgcaatcaccaaaggcacaagaaggcgtaggaggaagtggtctagcccggacgccatcttcagcgccctgctcgcccttctcctttgatgcatatcgggaaccccacacattgtcttttttttgctctgccttgtgcgcatcaattccaattctttcatccaccggacacttgacatgtatgtatagtatgtacccactccacgatcaacaaaatgagaaacgattgcctttccaagc</dnaseqindica>|
+
* University of Chinese Academy of Sciences, Beijing 100049, PR China
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060905.1 RefSeq:Os04g0692600]|
+
 
}}
+
==References==
[[Category:Genes]]
+
<references>
[[Category:Japonica mRNA]]
+
* <ref name="ref1">
[[Category:Oryza Sativa Japonica Group]]
+
Rong H, Tang Y, Zhang H, Wu P, Chen Y, Li M, Wu G, Jiang H. The Stay-Green
[[Category:Japonica Genes]]
+
Rice like (SGRL) gene regulates chlorophyll degradation in rice. J Plant Physiol.
[[Category:Japonica Chromosome 4]]
+
2013 Oct 15;170(15):1367-73. doi: 10.1016/j.jplph.2013.05.016. Epub 2013 Jun 28.  
[[Category:Chromosome 4]]
+
PubMed PMID: 23816327.
 +
</ref>
 +
</references>
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 4]]

Latest revision as of 03:01, 9 October 2016

The rice Os04g0692600 was reported as SGRL in 2013 [1] by researchers from Portugal.

Annotated Information

Figure 3. Analysis of SGRL and SGR expression by quantitative real-time PCR.[1].

Gene Symbol

  • Os04g0692600 <=> OsSGRL,SGRL

Function

  • Overexpression of SGRL reduces the levels of Chl and Chl-binding proteins in leaves, and accelerates their degradation in dark-induced senescence leaves in rice.
  • SGRL protein is involved in Chl degradation.

Expression

  • Real-time Fluorescence Quantitative PCR analysis was used to investigate the patterns of SRGL expression in six tissues from rice plants: roots, stems, young leaves, senescent leaves, panicles and seeds. SGRL was strongly expressed in green tissues (leaves, stems and panicles), but less in nonphotosynthetic tissues (roots and seeds)
  • The SGRL gene was strongly expressed during the transition from dark to light, but was less strongly expressed during the day. Conversely, SGR expression increased during the light period and peaked at noon.

Evolution

  • The SGR and SGRL proteins share a highly conserved central region consisting of approximately 120 amino acid residues, but differ at both the N- and C-termini.

You can also add sub-section(s) at will.

Labs working on this gene

  • Key Laboratory of Plant Resources Conservation and Sustainable Utilization, South China Botanical Garden, Chinese Academy of Sciences, Guangzhou 510650, PR China
  • University of Chinese Academy of Sciences, Beijing 100049, PR China

References

  1. 1.0 1.1 Rong H, Tang Y, Zhang H, Wu P, Chen Y, Li M, Wu G, Jiang H. The Stay-Green Rice like (SGRL) gene regulates chlorophyll degradation in rice. J Plant Physiol. 2013 Oct 15;170(15):1367-73. doi: 10.1016/j.jplph.2013.05.016. Epub 2013 Jun 28. PubMed PMID: 23816327.

Structured Information