Difference between revisions of "Os02g0512400"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os02g0512400| Description = Similar to Glutaredoxin| Version = NM_001053477.1 GI:115446324 GeneID:4329462| Length = 1024 bp| Definition = Oryza...")
 
(Subcellular localization)
 
(6 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os02g0512400''''' was reported as '''''OsGRX8''''' in 2013 <ref name="ref1" /> by researchers from India.  
GeneName = Os02g0512400|
 
Description = Similar to Glutaredoxin|
 
Version = NM_001053477.1 GI:115446324 GeneID:4329462|
 
Length = 1024 bp|
 
Definition = Oryza sativa Japonica Group Os02g0512400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
[[File:Os02g0512400.png|right|thumb|427px|'''Figure 1.''' ''subcellular localization of OsGRX8 in plant cells.<ref name="ref1" />.'']]
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
===Gene Symbol===
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
*'''''Os02g0512400''''' '''<=>''' '''''OsGRX8,GRX8'''''
|
+
===Function===
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
+
* The '''''OsGRX8''''' plays an important role in regulating abiotic stress response, it may be used to engineer stress tolerance in crop plants.
AP = Chromosome 2:19193158..19194181|
+
* The over-expression of '''''OsGRX8''''' in Arabidopsis plants conferred reduced sensitivity to auxin and stress hormone, abscisic acid. In addition, the transgenic Arabidopsis plants exhibited enhanced tolerance to various abiotic stresses, including salinity, osmotic and oxidative stress.
CDS = 19193328..19193735|
+
* Further, the transgenic RNAi rice plants exhibited increased susceptibility to various abiotic stresses, which further confirmed the role of '''''OsGRX8''''' in abiotic stress responses.
GCID = <gbrowseImage1>
+
===Expression===
name=NC_008395:19193158..19194181
+
* The transcript level of '''''OsGRX8''''' was up-regulated under desiccation and oxidative stress conditions significantly.
source=RiceChromosome02
+
* In addition, the transcript level of '''''OsGRX8''''' was significantly higher in the presence of plant hormone auxin.
preset=GeneLocation
+
 
</gbrowseImage1>|
+
===Subcellular localization===
GSID = <gbrowseImage2>
+
* Onion epidermal cells were used to determine subcellular localization of '''''OsGRX8''''' in living cells. The fusion protein (GFP::GRX) was transiently expressed under the control of constitutive promoter in onion epidermal cells.
name=NC_008395:19193158..19194181
+
* The localization of fusion protein and GFP was visualized by capturing the GFP fluorescence. The GFP::GRX fusion protein ('''''OsGRX8''''') was found to be localized in the cytosol and nucleus, whereas GFP alone was distributed in whole cel
source=RiceChromosome02
+
 
preset=GeneLocation
+
 
</gbrowseImage2>|
+
You can also add sub-section(s) at will.
CDNA = <cdnaseq>atgcagtacggagcggcggccgagcaggcgtggtacatgccggcggcggcgccggcaccgatggtggagagcgcggtggcgcgggtggagcggctggcgtcggagagcgcggtggtggtgttcagcgtgagcagctgctgcatgtgccacgccgtgaagcgcctcttctgcggcatgggggtgcacccgacggtgcacgagctggacctcgacccgcgcggccgcgagctggagcgcgccctggcgcgcctcgtcgggtacggcggccccgccgccgcgtcgccgcccgtcgtccccgtcgtcttcatcggcggcaagctcgtcggcgccatggaccgcgtcatggccgcgcacatcaacggctccctcgtccccctcctcaaggaggccggcgcgctctggctctag</cdnaseq>|
+
 
AA = <aaseq>MQYGAAAEQAWYMPAAAPAPMVESAVARVERLASESAVVVFSVS                    SCCMCHAVKRLFCGMGVHPTVHELDLDPRGRELERALARLVGYGGPAAASPPVVPVVF                    IGGKLVGAMDRVMAAHINGSLVPLLKEAGALWL</aaseq>|
+
==Labs working on this gene==
DNA = <dnaseqindica>171..578#tctccaagtgttcaagctcacctcagttgattctagcttagcaacacacaagcacacagctagctagctcagctctctgtgcttctctagctaagctaatcgttttcaggcgaaggaagcacacacatctccatttgtgcatcagatcaccggccaggtcgtcggcgagaatgcagtacggagcggcggccgagcaggcgtggtacatgccggcggcggcgccggcaccgatggtggagagcgcggtggcgcgggtggagcggctggcgtcggagagcgcggtggtggtgttcagcgtgagcagctgctgcatgtgccacgccgtgaagcgcctcttctgcggcatgggggtgcacccgacggtgcacgagctggacctcgacccgcgcggccgcgagctggagcgcgccctggcgcgcctcgtcgggtacggcggccccgccgccgcgtcgccgcccgtcgtccccgtcgtcttcatcggcggcaagctcgtcggcgccatggaccgcgtcatggccgcgcacatcaacggctccctcgtccccctcctcaaggaggccggcgcgctctggctctaggcctcgcccgcccgccattggcgtgctctggcttagcccccctagtatacctagcacgcaaaaagctttacctgctgctgctgctgctgctgctaatgaagaagatgaagatgatgatgatgactagcaagtagttgattgatttagctgctgctaataggatatccatcgatcgagatacagcccatttacacggtgctagctaattaatcagtgtgtgagtgagtgtgtgtttgagagtgagtgagctagagctagaagaagagagatcgaggttggtgtgtgtgtgcttttttcttcacgacgactgcctctgtccgtctcgtgcatgcttcgcgcgcgcgcgcgcgcatgtggttgtttgttggcgcgtgcgctggatttgcttgctttgatgctgcatgctattgctagctactgaaattactactaccagtgttttattt</dnaseqindica>|
+
* Functional and Applied Genomics Laboratory, National Institute of Plant Genome Research (NIPGR), Aruna Asaf Ali Marg, New Delhi 110067, India
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001053477.1 RefSeq:Os02g0512400]|
+
 
}}
+
==References==
[[Category:Genes]]
+
<references>
[[Category:Japonica mRNA]]
+
* <ref name="ref1">
[[Category:Oryza Sativa Japonica Group]]
+
Sharma R, Priya P, Jain M. Modified expression of an auxin-responsive rice CC-type glutaredoxin gene affects multiple abiotic stress responses. Planta. 2013 Nov;238(5):871-84. doi: 10.1007/s00425-013-1940-y.
[[Category:Japonica Genes]]
+
</ref>
[[Category:Japonica Chromosome 2]]
+
 
[[Category:Chromosome 2]]
+
</references>
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]

Latest revision as of 04:55, 9 October 2016

The rice Os02g0512400 was reported as OsGRX8 in 2013 [1] by researchers from India.

Annotated Information

Figure 1. subcellular localization of OsGRX8 in plant cells.[1].

Gene Symbol

  • Os02g0512400 <=> OsGRX8,GRX8

Function

  • The OsGRX8 plays an important role in regulating abiotic stress response, it may be used to engineer stress tolerance in crop plants.
  • The over-expression of OsGRX8 in Arabidopsis plants conferred reduced sensitivity to auxin and stress hormone, abscisic acid. In addition, the transgenic Arabidopsis plants exhibited enhanced tolerance to various abiotic stresses, including salinity, osmotic and oxidative stress.
  • Further, the transgenic RNAi rice plants exhibited increased susceptibility to various abiotic stresses, which further confirmed the role of OsGRX8 in abiotic stress responses.

Expression

  • The transcript level of OsGRX8 was up-regulated under desiccation and oxidative stress conditions significantly.
  • In addition, the transcript level of OsGRX8 was significantly higher in the presence of plant hormone auxin.

Subcellular localization

  • Onion epidermal cells were used to determine subcellular localization of OsGRX8 in living cells. The fusion protein (GFP::GRX) was transiently expressed under the control of constitutive promoter in onion epidermal cells.
  • The localization of fusion protein and GFP was visualized by capturing the GFP fluorescence. The GFP::GRX fusion protein (OsGRX8) was found to be localized in the cytosol and nucleus, whereas GFP alone was distributed in whole cel


You can also add sub-section(s) at will.

Labs working on this gene

  • Functional and Applied Genomics Laboratory, National Institute of Plant Genome Research (NIPGR), Aruna Asaf Ali Marg, New Delhi 110067, India

References

  1. 1.0 1.1 Sharma R, Priya P, Jain M. Modified expression of an auxin-responsive rice CC-type glutaredoxin gene affects multiple abiotic stress responses. Planta. 2013 Nov;238(5):871-84. doi: 10.1007/s00425-013-1940-y.

Structured Information