Difference between revisions of "Os03g0693700"

From RiceWiki
Jump to: navigation, search
(Phenotypic analysis)
 
(6 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os03g0693700''''' was reported as '''''Osoxo4''''' in 2013 <ref name="ref1" /> by researchers from India and the USA.  
  
 
==Annotated Information==
 
==Annotated Information==
===Function===
+
===Gene Symbol===
Please input function information here.
+
*'''''Os03g0693700''''' '''<=>''' '''''Osoxo4,oxo4'''''
 +
===Phenotypic analysis===
 +
* Overexpression of the '''''Osoxo4''''' gene in transgenic plants showed higher enzyme activity of oxalate oxidase (OxO) than nontransgenic control plants, which was visualized by histochemical assays and sodium dodecylsulphate-polyacrylamide gel electrophoresis (SDS-PAGE).
 +
* Transgenic rice leaves were more tolerant than control rice leaves to exogenous OA. Transgenic plants showed a higher level of expression of other defence-related genes in response to pathogen infection.
 +
* More importantly, transgenic plants exhibited significantly enhanced durable resistance to R. solani. The overexpression of Osoxo4 in rice did not show any detrimental phenotypic or agronomic effect.
 +
* The transgenic Osoxo4-overexpressing rice lines and nontrans-genic control plants were subjected to bioassay with a virulent Hyderabad isolate of R. solani AG1-1A. The transgenic lines showed an increased level of sheath blight resistance, as demon- strated by a low sheath blight score in comparison with nontransgenic control plants.
  
===Expression===
 
Please input expression information here.
 
  
===Evolution===
+
[[File:26-Os03g0693700.png|center|thumb|720px|'''Figure 7.''' ''Overexpression of rice oxalate oxidase 4 (Osoxo4) enhances resistance against the sheath blight pathogen Rhizoctonia solani<ref name="ref1" />.'']]
Please input evolution information here.
+
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Plant Molecular Biology and Biotechnology Laboratory, Department of Botany, University of Calcutta, 35, Ballygunge Circular Road, Kolkata 700019, India
 
+
* Center for Diabetes Research, The Methodist Hospital Research Institute, 6670 Bertner, Houston, TX 77030, USA
 +
* Division of Crop Science, Indian Council of Agricultural Research (ICAR), Krishi Bhavan, Dr. Rajendra Prasad Road, New Delhi 110001, India
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Molla KA, Karmakar S, Chanda PK, Ghosh S, Sarkar SN, Datta SK, Datta K. Rice
 +
oxalate oxidase gene driven by green tissue-specific promoter increases tolerance
 +
to sheath blight pathogen (Rhizoctonia solani) in transgenic rice. Mol Plant
 +
Pathol. 2013 Dec;14(9):910-22. doi: 10.1111/mpp.12055. Epub 2013 Jul 1. PubMed
 +
PMID: 23809026.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 3]]
GeneName = Os03g0693700|
 
Description = Similar to Oxalate oxidase 1 (EC 1.2.3.4) (Germin)|
 
Version = NM_001057500.1 GI:115454728 GeneID:4333791|
 
Length = 997 bp|
 
Definition = Oryza sativa Japonica Group Os03g0693700, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:28539529..28540525|
 
CDS = 28539717..28540400|
 
GCID = <gbrowseImage1>
 
name=NC_008396:28539529..28540525
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:28539529..28540525
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggagtgcttcaaaactaccctagctggggtggtgctcgtcgtgctgctcctgcagcaggcgccggtgctacgggccaacgaccctgaccctctccaagacttctgcgtcgccgacctcgacagcgaggtgacgttgaacgggtacccgtgcaagcccacgccggcggccggcgacgagttcctcttctcctccaggttagccacgggcggcgacgtgaacgccaaccccaacggctccaacgtcacgcagctcgacgtcgcggggtggcccggggtgaacacgctcggcgtgtccatgaaccgcatcgacttcgcgcccggcggcaccaacccgccgcacgtccacccgcgcgccaccgaggtcggcatcgtgctacgcggcgagctcctcgtcggcatcatcggcagcctcgacaccgggaacaggtactactccagggtggtccgcggcggcgagacgttcgtcatcccgcgggggctcatgcacttccagttcaacgtcggcaagacggaggccaccatggtggtgtccttcaacagccagaaccctggcatcgtcttcgtcccgctcacattgttcggctccaacccacccatcccgacgccggtgctcgtcaaggcgctccgggtggacgccggcgtcgtcgagctgcttaagtccaagttcaccggtgggtactga</cdnaseq>|
 
AA = <aaseq>MECFKTTLAGVVLVVLLLQQAPVLRANDPDPLQDFCVADLDSEV                    TLNGYPCKPTPAAGDEFLFSSRLATGGDVNANPNGSNVTQLDVAGWPGVNTLGVSMNR                    IDFAPGGTNPPHVHPRATEVGIVLRGELLVGIIGSLDTGNRYYSRVVRGGETFVIPRG                    LMHFQFNVGKTEATMVVSFNSQNPGIVFVPLTLFGSNPPIPTPVLVKALRVDAGVVEL                    LKSKFTGGY</aaseq>|
 
DNA = <dnaseqindica>126..809#acccaattagcaaagtagcttctatactactgcctctgccaggtgccatttcattactcaaagaaattgagccgagacctgaggaacatatacaagaattggctagctttgctcgttgattagcaatggagtgcttcaaaactaccctagctggggtggtgctcgtcgtgctgctcctgcagcaggcgccggtgctacgggccaacgaccctgaccctctccaagacttctgcgtcgccgacctcgacagcgaggtgacgttgaacgggtacccgtgcaagcccacgccggcggccggcgacgagttcctcttctcctccaggttagccacgggcggcgacgtgaacgccaaccccaacggctccaacgtcacgcagctcgacgtcgcggggtggcccggggtgaacacgctcggcgtgtccatgaaccgcatcgacttcgcgcccggcggcaccaacccgccgcacgtccacccgcgcgccaccgaggtcggcatcgtgctacgcggcgagctcctcgtcggcatcatcggcagcctcgacaccgggaacaggtactactccagggtggtccgcggcggcgagacgttcgtcatcccgcgggggctcatgcacttccagttcaacgtcggcaagacggaggccaccatggtggtgtccttcaacagccagaaccctggcatcgtcttcgtcccgctcacattgttcggctccaacccacccatcccgacgccggtgctcgtcaaggcgctccgggtggacgccggcgtcgtcgagctgcttaagtccaagttcaccggtgggtactgatctgacgatccgagagtattcttacgcggatctaggtctctgctactatagttgtgcgcagtgtatgttatttgattgaataaacttgtcgtcgccatcgcaggccacgaatgaaactaaaatgtattactactgctttcttgtgcttttccccttctaaataaactatacataaatggtattttggt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057500.1 RefSeq:Os03g0693700]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 3]]
 
[[Category:Chromosome 3]]
 

Latest revision as of 09:02, 9 October 2016

The rice Os03g0693700 was reported as Osoxo4 in 2013 [1] by researchers from India and the USA.

Annotated Information

Gene Symbol

  • Os03g0693700 <=> Osoxo4,oxo4

Phenotypic analysis

  • Overexpression of the Osoxo4 gene in transgenic plants showed higher enzyme activity of oxalate oxidase (OxO) than nontransgenic control plants, which was visualized by histochemical assays and sodium dodecylsulphate-polyacrylamide gel electrophoresis (SDS-PAGE).
  • Transgenic rice leaves were more tolerant than control rice leaves to exogenous OA. Transgenic plants showed a higher level of expression of other defence-related genes in response to pathogen infection.
  • More importantly, transgenic plants exhibited significantly enhanced durable resistance to R. solani. The overexpression of Osoxo4 in rice did not show any detrimental phenotypic or agronomic effect.
  • The transgenic Osoxo4-overexpressing rice lines and nontrans-genic control plants were subjected to bioassay with a virulent Hyderabad isolate of R. solani AG1-1A. The transgenic lines showed an increased level of sheath blight resistance, as demon- strated by a low sheath blight score in comparison with nontransgenic control plants.


Figure 7. Overexpression of rice oxalate oxidase 4 (Osoxo4) enhances resistance against the sheath blight pathogen Rhizoctonia solani[1].


You can also add sub-section(s) at will.

Labs working on this gene

  • Plant Molecular Biology and Biotechnology Laboratory, Department of Botany, University of Calcutta, 35, Ballygunge Circular Road, Kolkata 700019, India
  • Center for Diabetes Research, The Methodist Hospital Research Institute, 6670 Bertner, Houston, TX 77030, USA
  • Division of Crop Science, Indian Council of Agricultural Research (ICAR), Krishi Bhavan, Dr. Rajendra Prasad Road, New Delhi 110001, India

References

  1. 1.0 1.1 Molla KA, Karmakar S, Chanda PK, Ghosh S, Sarkar SN, Datta SK, Datta K. Rice oxalate oxidase gene driven by green tissue-specific promoter increases tolerance to sheath blight pathogen (Rhizoctonia solani) in transgenic rice. Mol Plant Pathol. 2013 Dec;14(9):910-22. doi: 10.1111/mpp.12055. Epub 2013 Jul 1. PubMed PMID: 23809026.

Structured Information