Difference between revisions of "Os05g0480000"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os05g0480000| Description = Protein kinase domain containing protein| Version = NM_001062386.1 GI:115464502 GeneID:4339115| Length = 2109 bp| D...")
 
(Annotated Information)
 
(6 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os05g0480000''''' was reported as '''''OsSTN8''''' in 2013 <ref name="ref1" /> by researchers from Korea, Mongolia, Russia.  
GeneName = Os05g0480000|
 
Description = Protein kinase domain containing protein|
 
Version = NM_001062386.1 GI:115464502 GeneID:4339115|
 
Length = 2109 bp|
 
Definition = Oryza sativa Japonica Group Os05g0480000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
[[File:27-Os05g0480000.png|right|thumb|327px|'''Figure 2.''' ''Transmission electron microscope analysis of chloroplasts from WT and osstn8 mutant plants.<ref name="ref1" />.'']]
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
===Gene Symbol===
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
*'''''Os05g0480000''''' '''<=>''' '''''OsSTN8,STN8'''''
|
+
===Function===
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
+
* STN8 kinase is involved in photosystem II (PSII) core protein phosphorylation (PCPP).
AP = Chromosome 5:23646198..23648306|
+
* Loss-of-function of OsSTN8 suppresses the photosystem II core protein phosphorylation and interferes with the photosystem II repair mechanism in rice.
CDS = 23647131..23647511,23647613..23647960|
+
===Phenotypic analysis===
GCID = <gbrowseImage1>
+
* The growth of osstn8 mutants was slower than that of WT (Figure S3a,c), and the growth retardation resulted in a flowering delay of approximately 7–10 days (Figure S3b).
name=NC_008398:23646198..23648306
+
* The contents of photosynthetic pigments were not significantly altered in osstn8 mutants compared with WT, but the chlorophyll a/b ratio was 3.2 in WT and 3.0 in osstn8 mutant leaves.
source=RiceChromosome05
+
===Transmission electron microscopy analysis===
preset=GeneLocation
+
* Several striking features were observed in the thylakoid membrane structure in osstn8 chloroplasts
</gbrowseImage1>|
+
* Transmission electron microscopy analysis revealed that stacking of the grana is significantly reduced and the length of grana is dramatically increased in the chloroplasts of osstn8 mutants under natural growth conditions (Figure 6b,d,f).
GSID = <gbrowseImage2>
+
 
name=NC_008398:23646198..23648306
+
===Expression===
source=RiceChromosome05
+
* The expression pattern of '''''OsSTN8''''' was determined by real-time PCR analysis (Figure 1d). '''''OsSTN8''''' was found to be highly expressed in leaves (photosynthetic organ).  
preset=GeneLocation
+
 
</gbrowseImage2>|
+
 
CDNA = <cdnaseq>atgagcgaccgcaacttccccttcaacctggagggcctcatgttcgggcgcgccgtgcgggggctcgacgacggcagccgcgccgcgctggtggtgaagcaggtgatgcggcagctggtgacctccctgaagcgcatccacggcaccggcatcgtccaccgcgacatcaagccgtccaacctcgtcgtcacccggcgggggcaggtgaagctcatcgacttcggcgccgccaccgacctccgcatcggcaagaactacgtccccgaccgcgccctcctcgacccggactactgcccgcctgagctctacgtcctccccgaggagacgccccagccgcccgccgagcccatcgccgccatcctctccccgatcctctggcagattaacagcccggacctgttcgacatgtactcggcggggatcgtgctgatgcagatggcgtcgccgatgctgaggtcgccgtcggggctcaagaacttcaacgccgagctcaaggccgccgggtacgacctcaaccggtggcgggagaccacgcggcggagacccgacctgcagatcctcgacctcgactccggcagggggtgggacctcgccaccaagctcatctcgcagcgcggcgccgacaagcgcggccgcctcaccgccgccgccgccctgcgccacccttacttcctcctcggcggcgaccaggccgccgccgtcttgtccaagctgtcactcagcaagtag</cdnaseq>|
+
You can also add sub-section(s) at will.
AA = <aaseq>MSDRNFPFNLEGLMFGRAVRGLDDGSRAALVVKQVMRQLVTSLK                    RIHGTGIVHRDIKPSNLVVTRRGQVKLIDFGAATDLRIGKNYVPDRALLDPDYCPPEL                    YVLPEETPQPPAEPIAAILSPILWQINSPDLFDMYSAGIVLMQMASPMLRSPSGLKNF                    NAELKAAGYDLNRWRETTRRRPDLQILDLDSGRGWDLATKLISQRGADKRGRLTAAAA                    LRHPYFLLGGDQAAAVLSKLSLSK</aaseq>|
+
 
DNA = <dnaseqindica>934..1314#1416..1763#agctggacgagaggtacaaggagaaggtgatactgaagaagatcaaggtggggacggcgggggcgaaggagtgcggcgactacgaggagtggttcaactaccgggtggcaagggcggcgccggagtcgtgcgccgagttcctcggcagcttcgtcgccgacaagaccaagtccgagttcgtcaagggcggcaaatggctcgtctggaaattcgaggtaaattcgacatcaactcatcagttaatgcttgatgctagtatgaactgctgcaaccacatgcagcacagaaaattagtagtagtaacaacaattttaggaatcactaagctttttttttttttacgcaaaaaggtagagagtctctatcttatattccattatagaaatggcggtcaaagtacatggccaaatggccaaagaaaggtaaaaggaatacagaaaaaaggttacactggaaatggaagaaggagaaaggaatcactaagctagcttatagcatgcaaaaatctcaacagcctttaaactttaaacccaaaatttgaactgcttttatattttaaactcggtaatatgaagttttcaagctttttaaacgcaaatgagacataatccactctgtgatacaaaactttgaaagaatcaccaagcttacactacgcaaaaaagttcaataactttgtgatacaaaattttcaagtttttaagcccaaatgattcaaaaaattaaacccaaacgaaatgcaatatgattaaaaaaaagataaattggcccatgcaggtctcgaacctgcgaccttcgcgttattagcacgacgctctaaccagctgagctaataggccttgttcttttatatttgaaaaaaaacattcaaattttttaaacatgatttctggcgcgaattcatggcagggtgaccggacgctgggcaactacatgagcgaccgcaacttccccttcaacctggagggcctcatgttcgggcgcgccgtgcgggggctcgacgacggcagccgcgccgcgctggtggtgaagcaggtgatgcggcagctggtgacctccctgaagcgcatccacggcaccggcatcgtccaccgcgacatcaagccgtccaacctcgtcgtcacccggcgggggcaggtgaagctcatcgacttcggcgccgccaccgacctccgcatcggcaagaactacgtccccgaccgcgccctcctcgacccggactactgcccgcctgagctctacgtcctccccgaggagacgccccagccgcccgccgagcccatcgccgccatcctctccccgatcctctggcaggtgtcgaacacctcacaccttcttcttcttcttcctctccgttcaatcttgcgccgccgtcgatcaccgtcgtcgcgttgctgtttcttggctgaatgcagattaacagcccggacctgttcgacatgtactcggcggggatcgtgctgatgcagatggcgtcgccgatgctgaggtcgccgtcggggctcaagaacttcaacgccgagctcaaggccgccgggtacgacctcaaccggtggcgggagaccacgcggcggagacccgacctgcagatcctcgacctcgactccggcagggggtgggacctcgccaccaagctcatctcgcagcgcggcgccgacaagcgcggccgcctcaccgccgccgccgccctgcgccacccttacttcctcctcggcggcgaccaggccgccgccgtcttgtccaagctgtcactcagcaagtaggttatacaaaacaactcaatgcacaaaattaagaacacatgcagtgatcaggtcaccactcaccaatggcattagcatttttgtttatgatccattggagagatcaagaactcaagattgatccaagagagagggaaaaggaggaggaagaaacaatatggtaatatataattacattgttttgtatgaggttaatcactttgaacagtgcggtgcagagtttgcagacactagctaacttaacttaattactgcccgtattcggactgaactctactgagaaatccctacttctgttggtcagcttcttgcaacctatgtagatttctgaactgtttcttcagcc</dnaseqindica>|
+
==Labs working on this gene==
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001062386.1 RefSeq:Os05g0480000]|
+
* Department of Molecular Biology, Pusan National University, Busan 609–735, Korea
}}
+
* Department of New Biology, Daegu Gyeongbuk Institute of Science and Technology, Daegu 711–873, Korea
[[Category:Genes]]
+
* Crop Biotech Institute and Graduate School of Biotechnology, Kyung Hee University, Yongin 446–701, Korea
[[Category:Japonica mRNA]]
+
* Center for Core Research Facilities, Daegu Gyeongbuk Institute of Science and Technology, Daegu 711–873, Korea
[[Category:Oryza Sativa Japonica Group]]
+
* Department of Biology, North-Eastern Federal University, 58 Belinsky Street, Yakutsk 677–027, Russia
[[Category:Japonica Genes]]
+
* Department of Biology, Mongolian State University of Agriculture, Zaisan 17024, Ulaanbaatar, Mongolia
[[Category:Japonica Chromosome 5]]
+
* Department of Biology, Kyungpook National University, Daegu 702–701, Korea
[[Category:Chromosome 5]]
+
 
 +
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Nath K, Poudyal RS, Eom JS, Park YS, Zulfugarov IS, Mishra SR, Tovuu A, Ryoo
 +
N, Yoon HS, Nam HG, An G, Jeon JS, Lee CH. Loss-of-function of OsSTN8 suppresses
 +
the photosystem II core protein phosphorylation and interferes with the
 +
photosystem II repair mechanism in rice (Oryza sativa). Plant J. 2013
 +
Nov;76(4):675-86. doi: 10.1111/tpj.12331. PubMed PMID: 24103067.
 +
 
 +
</ref>
 +
</references>
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 5]]

Latest revision as of 09:27, 9 October 2016

The rice Os05g0480000 was reported as OsSTN8 in 2013 [1] by researchers from Korea, Mongolia, Russia.

Annotated Information

Figure 2. Transmission electron microscope analysis of chloroplasts from WT and osstn8 mutant plants.[1].

Gene Symbol

  • Os05g0480000 <=> OsSTN8,STN8

Function

  • STN8 kinase is involved in photosystem II (PSII) core protein phosphorylation (PCPP).
  • Loss-of-function of OsSTN8 suppresses the photosystem II core protein phosphorylation and interferes with the photosystem II repair mechanism in rice.

Phenotypic analysis

  • The growth of osstn8 mutants was slower than that of WT (Figure S3a,c), and the growth retardation resulted in a flowering delay of approximately 7–10 days (Figure S3b).
  • The contents of photosynthetic pigments were not significantly altered in osstn8 mutants compared with WT, but the chlorophyll a/b ratio was 3.2 in WT and 3.0 in osstn8 mutant leaves.

Transmission electron microscopy analysis

  • Several striking features were observed in the thylakoid membrane structure in osstn8 chloroplasts
  • Transmission electron microscopy analysis revealed that stacking of the grana is significantly reduced and the length of grana is dramatically increased in the chloroplasts of osstn8 mutants under natural growth conditions (Figure 6b,d,f).

Expression

  • The expression pattern of OsSTN8 was determined by real-time PCR analysis (Figure 1d). OsSTN8 was found to be highly expressed in leaves (photosynthetic organ).


You can also add sub-section(s) at will.

Labs working on this gene

  • Department of Molecular Biology, Pusan National University, Busan 609–735, Korea
  • Department of New Biology, Daegu Gyeongbuk Institute of Science and Technology, Daegu 711–873, Korea
  • Crop Biotech Institute and Graduate School of Biotechnology, Kyung Hee University, Yongin 446–701, Korea
  • Center for Core Research Facilities, Daegu Gyeongbuk Institute of Science and Technology, Daegu 711–873, Korea
  • Department of Biology, North-Eastern Federal University, 58 Belinsky Street, Yakutsk 677–027, Russia
  • Department of Biology, Mongolian State University of Agriculture, Zaisan 17024, Ulaanbaatar, Mongolia
  • Department of Biology, Kyungpook National University, Daegu 702–701, Korea

References

  1. 1.0 1.1 Nath K, Poudyal RS, Eom JS, Park YS, Zulfugarov IS, Mishra SR, Tovuu A, Ryoo N, Yoon HS, Nam HG, An G, Jeon JS, Lee CH. Loss-of-function of OsSTN8 suppresses the photosystem II core protein phosphorylation and interferes with the photosystem II repair mechanism in rice (Oryza sativa). Plant J. 2013 Nov;76(4):675-86. doi: 10.1111/tpj.12331. PubMed PMID: 24103067.

Structured Information