Difference between revisions of "Os01g0248900"

From RiceWiki
Jump to: navigation, search
(References)
m (Annotated Information)
 
(11 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os01g0248900''''' was reported as '''''OsEXPA8''''' in 2013 <ref name="ref1" /> by researchers from Korea, Mongolia, Russia.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:28-Os01g0248900.png|right|thumb|327px|'''Figure 3.''' ''Morphological changes in 35S :: OsEXPA8 transgenic lines.<ref name="ref1" />.'']]
 +
===Gene Symbol===
 +
*'''''Os01g0248900''''' '''<=>''' '''''OsEXPA8,EXPA8'''''
 
===Function===
 
===Function===
Please input function information here.
+
* Accumulation of '''''OsEXPA8''''' in Cell Wall Enlarges Cell Size.
 +
* The Growth of Suspension-cultured Cells is Significantly Increased by '''''OsEXPA8''''' Overexpression
 +
* Overexpression of '''''OsEXPA8''''', Improves Rice Growth and Root System Architecture by Facilitating Cell Extension
  
===Expression===
+
===Phenotypic analysis===
Please input expression information here.
+
* Overexpression of '''''OsEXPA8''''' yielded pleiotropic phenotypes in the root system architecture (Figure 3A–F), plant height, leaf number and leaf size (Figure 3G and H).
 
+
* Compared to wild-type plants, 35S::OsEXPA8 transgenic lines showed similar morphological phenotypes: the length of primary roots (Figure 3A) and number of lateral roots were significantly increased (t-test, P,0.01).
===Evolution===
+
* The size of root hairs in the root apex of 35S::OsEXPA8 plants has been increased clearly by stereoscope (Figure 3B and C) and Cryo-SEM images (Figure 3D and E). At maturity, the difference of the root system architecture between transgenic lines and wild-type plants was also significant, and transgenic lines developed more and longer roots (including lateral and adventurous roots) (Figure 3F).
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Bioengineering College, Chongqing University, Chongqing, China
  
 
==References==
 
==References==
1. The Rice Annotation Project Database (RAP-DB): 2008 update. Rice Annotation Project, et al. Nucleic Acids Res, 2008 Jan.
+
<references>
 
+
* <ref name="ref1">
2. Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana. Rice Annotation Project, et al. Genome Res, 2007 Feb.
+
Ma N, Wang Y, Qiu S, Kang Z, Che S, Wang G, Huang J. Overexpression of
 
+
OsEXPA8, a root-specific gene, improves rice growth and root system architecture
3. The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information. Ohyanagi H, et al. Nucleic Acids Res, 2006 Jan 1.
+
by facilitating cell extension. PLoS One. 2013 Oct 4;8(10):e75997. doi:
 
+
10.1371/journal.pone.0075997. eCollection 2013. PubMed PMID: 24124527;
4. The map-based sequence of the rice genome. International Rice Genome Sequencing Project. Nature, 2005 Aug 11.
+
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os01g0248900|
 
Description = Similar to Expansin Os-EXPA3|
 
Version = NM_001049122.1 GI:115435657 GeneID:4327217|
 
Length = 1014 bp|
 
Definition = Oryza sativa Japonica Group Os01g0248900, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:8195063..8196076|
 
CDS = 8195191..8195819,8195941..8196067|
 
GCID = <gbrowseImage1>
 
name=NC_008394:8195063..8196076
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:8195063..8196076
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcggccgccagaatgctcgtgctcctggcctctctctgcgctctcctgctcacggcgtccgcggccaaatggactcctgccttcgcgacgttctacggcggcagcgacgcctccggcaccatgggcggcgcatgcgggtacggcgacctgtacggcgccgggtacgggacgcggacggcggcgctgagcacggcgctgttcaacggcggcgcgtcgtgcggcgcctgcttcaccatcgcctgcgacacccgcaagacgcagtggtgcaagccggggacgtccatcaccgtgacggcgaccaacttctgccctccaaactacgccctgtccggcgacgccggcgggtggtgcaacccgccgcgccgccacttcgacatgtcgcagccggcgtgggagacgatcgcggtgtaccgcgccgggatcgtgcccgtgaactaccgccgcgtgccgtgccagcggagcggcggcatccggttcgccgtgaacgggcacagctacttcgagctggtgctggtgacgaacgtcggcggcagcggcgcggtggcgcagatgtggatcaaggggtccgggacggggtggatggcgatgagccgcaactggggcgcgaactggcagagcaacgcgcgcctcgacgggcaggcgctgtcgttccgggtgcaggccgacgacggccgcgtcgtcacggcggccgacgtcgcgccggcggggtggtcgttcggcgccacctacacctcctcggctcagttctactga</cdnaseq>|
 
AA = <aaseq>MAAARMLVLLASLCALLLTASAAKWTPAFATFYGGSDASGTMGG                    ACGYGDLYGAGYGTRTAALSTALFNGGASCGACFTIACDTRKTQWCKPGTSITVTATN                    FCPPNYALSGDAGGWCNPPRRHFDMSQPAWETIAVYRAGIVPVNYRRVPCQRSGGIRF                    AVNGHSYFELVLVTNVGGSGAVAQMWIKGSGTGWMAMSRNWGANWQSNARLDGQALSF                    RVQADDGRVVTAADVAPAGWSFGATYTSSAQFY</aaseq>|
 
DNA = <dnaseqindica>258..886#10..136#gacgcgacaatggcggccgccagaatgctcgtgctcctggcctctctctgcgctctcctgctcacggcgtccgcggccaaatggactcctgccttcgcgacgttctacggcggcagcgacgcctccggcaccatgggttagtagcaaattaagctcagctaatcaccatgcatgtgttaattaatcttttgcaaagtttaattggcatttacaataatggagtttggtctctctctcgtctcgtgtgtgatatccaggcggcgcatgcgggtacggcgacctgtacggcgccgggtacgggacgcggacggcggcgctgagcacggcgctgttcaacggcggcgcgtcgtgcggcgcctgcttcaccatcgcctgcgacacccgcaagacgcagtggtgcaagccggggacgtccatcaccgtgacggcgaccaacttctgccctccaaactacgccctgtccggcgacgccggcgggtggtgcaacccgccgcgccgccacttcgacatgtcgcagccggcgtgggagacgatcgcggtgtaccgcgccgggatcgtgcccgtgaactaccgccgcgtgccgtgccagcggagcggcggcatccggttcgccgtgaacgggcacagctacttcgagctggtgctggtgacgaacgtcggcggcagcggcgcggtggcgcagatgtggatcaaggggtccgggacggggtggatggcgatgagccgcaactggggcgcgaactggcagagcaacgcgcgcctcgacgggcaggcgctgtcgttccgggtgcaggccgacgacggccgcgtcgtcacggcggccgacgtcgcgccggcggggtggtcgttcggcgccacctacacctcctcggctcagttctactgatgagcattaattgcaagcctatctcatttaattaatctggaccgttcgatgtagtatattgtatgctttgatcgacgtggcataggatggaagaggccgcccacgaagaaaatttgggacttgtgtat</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001049122.1 RefSeq:Os01g0248900]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 13:09, 9 October 2016

The rice Os01g0248900 was reported as OsEXPA8 in 2013 [1] by researchers from Korea, Mongolia, Russia.

Annotated Information

Figure 3. Morphological changes in 35S :: OsEXPA8 transgenic lines.[1].

Gene Symbol

  • Os01g0248900 <=> OsEXPA8,EXPA8

Function

  • Accumulation of OsEXPA8 in Cell Wall Enlarges Cell Size.
  • The Growth of Suspension-cultured Cells is Significantly Increased by OsEXPA8 Overexpression
  • Overexpression of OsEXPA8, Improves Rice Growth and Root System Architecture by Facilitating Cell Extension

Phenotypic analysis

  • Overexpression of OsEXPA8 yielded pleiotropic phenotypes in the root system architecture (Figure 3A–F), plant height, leaf number and leaf size (Figure 3G and H).
  • Compared to wild-type plants, 35S::OsEXPA8 transgenic lines showed similar morphological phenotypes: the length of primary roots (Figure 3A) and number of lateral roots were significantly increased (t-test, P,0.01).
  • The size of root hairs in the root apex of 35S::OsEXPA8 plants has been increased clearly by stereoscope (Figure 3B and C) and Cryo-SEM images (Figure 3D and E). At maturity, the difference of the root system architecture between transgenic lines and wild-type plants was also significant, and transgenic lines developed more and longer roots (including lateral and adventurous roots) (Figure 3F).

You can also add sub-section(s) at will.

Labs working on this gene

  • Bioengineering College, Chongqing University, Chongqing, China

References

  1. 1.0 1.1 Ma N, Wang Y, Qiu S, Kang Z, Che S, Wang G, Huang J. Overexpression of OsEXPA8, a root-specific gene, improves rice growth and root system architecture by facilitating cell extension. PLoS One. 2013 Oct 4;8(10):e75997. doi: 10.1371/journal.pone.0075997. eCollection 2013. PubMed PMID: 24124527;

Structured Information