Difference between revisions of "Os01g0248900"

From RiceWiki
Jump to: navigation, search
(Expression)
m (Annotated Information)
 
(10 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os01g0248900''''' was reported as '''''OsEXPA8''''' in 2013 <ref name="ref1" /> by researchers from Korea, Mongolia, Russia.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:28-Os01g0248900.png|right|thumb|327px|'''Figure 3.''' ''Morphological changes in 35S :: OsEXPA8 transgenic lines.<ref name="ref1" />.'']]
 +
===Gene Symbol===
 +
*'''''Os01g0248900''''' '''<=>''' '''''OsEXPA8,EXPA8'''''
 
===Function===
 
===Function===
Please input function information here.
+
* Accumulation of '''''OsEXPA8''''' in Cell Wall Enlarges Cell Size.
 +
* The Growth of Suspension-cultured Cells is Significantly Increased by '''''OsEXPA8''''' Overexpression
 +
* Overexpression of '''''OsEXPA8''''', Improves Rice Growth and Root System Architecture by Facilitating Cell Extension
  
===Expression===
+
===Phenotypic analysis===
Rare lipoprotein A (RlpA) contains a conserved region that has the double-psi beta-barrel (DPBB) fold. The function of RlpA is not well understood, but it has been shown to act as a prc mutant suppressor in Escherichia coli. The DPBB fold is often an enzymatic domain. The members of this family are quite diverse, and if catalytic this family may contain several different functions. Another example of this domain is found in the N terminus of pollen allergen.
+
* Overexpression of '''''OsEXPA8''''' yielded pleiotropic phenotypes in the root system architecture (Figure 3A–F), plant height, leaf number and leaf size (Figure 3G and H).
[[Os01g0248900_protein_3D_structure.png]]
+
* Compared to wild-type plants, 35S::OsEXPA8 transgenic lines showed similar morphological phenotypes: the length of primary roots (Figure 3A) and number of lateral roots were significantly increased (t-test, P,0.01).
 
+
* The size of root hairs in the root apex of 35S::OsEXPA8 plants has been increased clearly by stereoscope (Figure 3B and C) and Cryo-SEM images (Figure 3D and E). At maturity, the difference of the root system architecture between transgenic lines and wild-type plants was also significant, and transgenic lines developed more and longer roots (including lateral and adventurous roots) (Figure 3F).
===Evolution===
 
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Bioengineering College, Chongqing University, Chongqing, China
  
 
==References==
 
==References==
1. The Rice Annotation Project Database (RAP-DB): 2008 update. Rice Annotation Project, et al. Nucleic Acids Res, 2008 Jan.
+
<references>
 
+
* <ref name="ref1">
2. Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana. Rice Annotation Project, et al. Genome Res, 2007 Feb.
+
Ma N, Wang Y, Qiu S, Kang Z, Che S, Wang G, Huang J. Overexpression of
 
+
OsEXPA8, a root-specific gene, improves rice growth and root system architecture
3. The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information. Ohyanagi H, et al. Nucleic Acids Res, 2006 Jan 1.
+
by facilitating cell extension. PLoS One. 2013 Oct 4;8(10):e75997. doi:
 
+
10.1371/journal.pone.0075997. eCollection 2013. PubMed PMID: 24124527;
4. The map-based sequence of the rice genome. International Rice Genome Sequencing Project. Nature, 2005 Aug 11.
+
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os01g0248900|
 
Description = Similar to Expansin Os-EXPA3|
 
Version = NM_001049122.1 GI:115435657 GeneID:4327217|
 
Length = 1014 bp|
 
Definition = Oryza sativa Japonica Group Os01g0248900, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:8195063..8196076|
 
CDS = 8195191..8195819,8195941..8196067|
 
GCID = <gbrowseImage1>
 
name=NC_008394:8195063..8196076
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:8195063..8196076
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcggccgccagaatgctcgtgctcctggcctctctctgcgctctcctgctcacggcgtccgcggccaaatggactcctgccttcgcgacgttctacggcggcagcgacgcctccggcaccatgggcggcgcatgcgggtacggcgacctgtacggcgccgggtacgggacgcggacggcggcgctgagcacggcgctgttcaacggcggcgcgtcgtgcggcgcctgcttcaccatcgcctgcgacacccgcaagacgcagtggtgcaagccggggacgtccatcaccgtgacggcgaccaacttctgccctccaaactacgccctgtccggcgacgccggcgggtggtgcaacccgccgcgccgccacttcgacatgtcgcagccggcgtgggagacgatcgcggtgtaccgcgccgggatcgtgcccgtgaactaccgccgcgtgccgtgccagcggagcggcggcatccggttcgccgtgaacgggcacagctacttcgagctggtgctggtgacgaacgtcggcggcagcggcgcggtggcgcagatgtggatcaaggggtccgggacggggtggatggcgatgagccgcaactggggcgcgaactggcagagcaacgcgcgcctcgacgggcaggcgctgtcgttccgggtgcaggccgacgacggccgcgtcgtcacggcggccgacgtcgcgccggcggggtggtcgttcggcgccacctacacctcctcggctcagttctactga</cdnaseq>|
 
AA = <aaseq>MAAARMLVLLASLCALLLTASAAKWTPAFATFYGGSDASGTMGG                    ACGYGDLYGAGYGTRTAALSTALFNGGASCGACFTIACDTRKTQWCKPGTSITVTATN                    FCPPNYALSGDAGGWCNPPRRHFDMSQPAWETIAVYRAGIVPVNYRRVPCQRSGGIRF                    AVNGHSYFELVLVTNVGGSGAVAQMWIKGSGTGWMAMSRNWGANWQSNARLDGQALSF                    RVQADDGRVVTAADVAPAGWSFGATYTSSAQFY</aaseq>|
 
DNA = <dnaseqindica>258..886#10..136#gacgcgacaatggcggccgccagaatgctcgtgctcctggcctctctctgcgctctcctgctcacggcgtccgcggccaaatggactcctgccttcgcgacgttctacggcggcagcgacgcctccggcaccatgggttagtagcaaattaagctcagctaatcaccatgcatgtgttaattaatcttttgcaaagtttaattggcatttacaataatggagtttggtctctctctcgtctcgtgtgtgatatccaggcggcgcatgcgggtacggcgacctgtacggcgccgggtacgggacgcggacggcggcgctgagcacggcgctgttcaacggcggcgcgtcgtgcggcgcctgcttcaccatcgcctgcgacacccgcaagacgcagtggtgcaagccggggacgtccatcaccgtgacggcgaccaacttctgccctccaaactacgccctgtccggcgacgccggcgggtggtgcaacccgccgcgccgccacttcgacatgtcgcagccggcgtgggagacgatcgcggtgtaccgcgccgggatcgtgcccgtgaactaccgccgcgtgccgtgccagcggagcggcggcatccggttcgccgtgaacgggcacagctacttcgagctggtgctggtgacgaacgtcggcggcagcggcgcggtggcgcagatgtggatcaaggggtccgggacggggtggatggcgatgagccgcaactggggcgcgaactggcagagcaacgcgcgcctcgacgggcaggcgctgtcgttccgggtgcaggccgacgacggccgcgtcgtcacggcggccgacgtcgcgccggcggggtggtcgttcggcgccacctacacctcctcggctcagttctactgatgagcattaattgcaagcctatctcatttaattaatctggaccgttcgatgtagtatattgtatgctttgatcgacgtggcataggatggaagaggccgcccacgaagaaaatttgggacttgtgtat</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001049122.1 RefSeq:Os01g0248900]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 13:09, 9 October 2016

The rice Os01g0248900 was reported as OsEXPA8 in 2013 [1] by researchers from Korea, Mongolia, Russia.

Annotated Information

Figure 3. Morphological changes in 35S :: OsEXPA8 transgenic lines.[1].

Gene Symbol

  • Os01g0248900 <=> OsEXPA8,EXPA8

Function

  • Accumulation of OsEXPA8 in Cell Wall Enlarges Cell Size.
  • The Growth of Suspension-cultured Cells is Significantly Increased by OsEXPA8 Overexpression
  • Overexpression of OsEXPA8, Improves Rice Growth and Root System Architecture by Facilitating Cell Extension

Phenotypic analysis

  • Overexpression of OsEXPA8 yielded pleiotropic phenotypes in the root system architecture (Figure 3A–F), plant height, leaf number and leaf size (Figure 3G and H).
  • Compared to wild-type plants, 35S::OsEXPA8 transgenic lines showed similar morphological phenotypes: the length of primary roots (Figure 3A) and number of lateral roots were significantly increased (t-test, P,0.01).
  • The size of root hairs in the root apex of 35S::OsEXPA8 plants has been increased clearly by stereoscope (Figure 3B and C) and Cryo-SEM images (Figure 3D and E). At maturity, the difference of the root system architecture between transgenic lines and wild-type plants was also significant, and transgenic lines developed more and longer roots (including lateral and adventurous roots) (Figure 3F).

You can also add sub-section(s) at will.

Labs working on this gene

  • Bioengineering College, Chongqing University, Chongqing, China

References

  1. 1.0 1.1 Ma N, Wang Y, Qiu S, Kang Z, Che S, Wang G, Huang J. Overexpression of OsEXPA8, a root-specific gene, improves rice growth and root system architecture by facilitating cell extension. PLoS One. 2013 Oct 4;8(10):e75997. doi: 10.1371/journal.pone.0075997. eCollection 2013. PubMed PMID: 24124527;

Structured Information