Difference between revisions of "Os01g0816100"

From RiceWiki
Jump to: navigation, search
(References)
 
(12 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
*OsNAC4 encodes a plant-specific transcription factor, leads to HR cell death accompanied by the loss of plasma membrane integrity, nuclear DNA fragmentation and typical morphological changes.
 
+
<br>
==Annotated Information==
+
[[File:20-f1.png |right |thumb |10000px |''''''Figure 1 Cell death induction by OsNAC4. (A) Cell death was induced in cultured rice cells by co-introduction of OsNAC4 gene(pAHC17-OsNAC4) or OsNAC6 (pAHC17-OsNAC6) and GUS. After transformation by particle bombardment, GUS activity in each cell was detected histochemically. The relative intensity of GUS staining is shown in the right graph. The mean values with error bars were derived from 10 independent experiments. (B) GUS activity in a rice leaf 24 h after transformation. GUS activity was measured after cointroduction of OsNAC4 (pAHC17-OsNAC4) and GUS (right) or GUS alone (left). pAHC17 was used for control experiments. The experiments were carried out in three different biological materials.(C) Protoplasts were transfected with the pAHC17 (control) or pAHC17-OsNAC4 vectors. After 12 h, protoplasts were incubated in 0.05% Evans blue for 5 min. (D) Protoplasts were transfected with pAHC17 (control) or pAHC17-OsNAC4. Twelve hours after transfection, dead protoplasts were scored using a light microscope.Values on the y-axis describe the percentage of dead cell in transfected protoplasts. Each determination was done with at least 1000 cells in each experiment. The mean values with error bars were derived from five independent experiments.]]
 +
<br>
 
===Function===
 
===Function===
Please input function information here.
+
*OsNAC4 encodes a plant-specific transcription factor, leads to HR cell death accompanied by the loss of plasma membrane integrity.
 
+
*nuclear DNA fragmentation and typical morphological changes.
===Expression===
+
*OsNAC4 is translocated into the nucleus in a phosphorylation-dependent manner.  
Please input expression information here.
+
<br>
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Graduate School of Biological Sciences, Nara Institute of Science and Technology (NAIST), Takayama Ikoma, Nara, Japan
 +
*Graduate School of Bio-Science, Nagahama Institute of Bio-Science and Technology, Tamura Nagahama, Shiga, Japan
 +
<br>
  
 
==References==
 
==References==
Please input cited references here.
+
*'''Alvarez ME, Pennell RI, Meijer PJ, Ishikawa A, Dixon RA, Lamb C (1998)''' Reactive oxygen intermediates mediate a systemic signal network in the establishment of plant immunity. Cell 92:773–784.
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
GeneName = Os01g0816100|
 
Description = Similar to NAC domain protein|
 
Version = NM_001051152.2 GI:297597853 GeneID:4327485|
 
Length = 1499 bp|
 
Definition = Oryza sativa Japonica Group Os01g0816100, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:36448724..36450222|
 
CDS = 36448964..36449431,36449532..36449818,36449917..36450118|
 
GCID = <gbrowseImage1>
 
name=NC_008394:36448724..36450222
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:36448724..36450222
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggaaatggcggcggcggttgggggcagcgggaggagggacgcggaggcggagctgaacctgccgccgggcttccgtttccacccgaccgacgaggagctcgtggtgcactacctctgccgcaaggttgcccggcagccgctccccgtcccaatcatcgccgaggtcgacctctacaagctcgacccctgggatctccctgagaaggcgttgttcgggaggaaagagtggtacttcttcacgccgagggaccggaagtacccgaacgggtcgaggccgaaccgcgcagcggggagagggtactggaaggcgacgggagccgacaagccggtggcgcccaaggggagcgcgaggacggtggggatcaagaaggcgctcgtgttctactccgggaaggcgccgaggggggtcaagacggactggatcatgcacgagtaccgcctcgccgacgccgaccgcgccccgggcggcaagaagggctcacagaagctggacgagtgggtgctgtgccggctgtacaacaagaagaacaactgggagaaggtgaagctggagcagcaggacgtggcctccgtggcggcggcggcgccgcgcaaccaccaccatcagaacggcgaggtcatggacgcggcggcggctgacaccatgtccgacagcttccagacgcacgactccgacatcgacaacgcctccgccggcctgcggcacggtggctgcggcggcggcggcttcggcgacgtggcgccgccgaggaatgggttcgtgacggtgaaggaggacaacgactggttcaccggcctcaacttcgacgagctgcagccgccgtacatgatgaacctgcagcacatgcagatgcagatggtgaatccggcggcgccagggcacgacggcggctacttgcagtccatcagctcgccgcagatgaagatgtggcagacaatcctgccaccattctga</cdnaseq>|
 
AA = <aaseq>MEMAAAVGGSGRRDAEAELNLPPGFRFHPTDEELVVHYLCRKVA                    RQPLPVPIIAEVDLYKLDPWDLPEKALFGRKEWYFFTPRDRKYPNGSRPNRAAGRGYW                    KATGADKPVAPKGSARTVGIKKALVFYSGKAPRGVKTDWIMHEYRLADADRAPGGKKG                    SQKLDEWVLCRLYNKKNNWEKVKLEQQDVASVAAAAPRNHHHQNGEVMDAAAADTMSD                    SFQTHDSDIDNASAGLRHGGCGGGGFGDVAPPRNGFVTVKEDNDWFTGLNFDELQPPY                    MMNLQHMQMQMVNPAAPGHDGGYLQSISSPQMKMWQTILPPF</aaseq>|
 
DNA = <dnaseqindica>792..1259#405..691#105..306#gccacggaagcgcagcatcaacaaaggcagcagcagcagcagcagcagcagcagcgttggtggtggtggtgtgtcatcaccaacattttcacgagaggagaaggatggaaatggcggcggcggttgggggcagcgggaggagggacgcggaggcggagctgaacctgccgccgggcttccgtttccacccgaccgacgaggagctcgtggtgcactacctctgccgcaaggttgcccggcagccgctccccgtcccaatcatcgccgaggtcgacctctacaagctcgacccctgggatctccctggtacgtacgcctcttcttttcttggtactctccgtcgatctgttcatccattggtttggttttgtgtctgatgtttgtgtggttttgtgtgtgcgcagagaaggcgttgttcgggaggaaagagtggtacttcttcacgccgagggaccggaagtacccgaacgggtcgaggccgaaccgcgcagcggggagagggtactggaaggcgacgggagccgacaagccggtggcgcccaaggggagcgcgaggacggtggggatcaagaaggcgctcgtgttctactccgggaaggcgccgaggggggtcaagacggactggatcatgcacgagtaccgcctcgccgacgccgaccgcgccccgggcggcaagaagggctcacagaaggtaggcgtcgtgacgacgcgtactccgacgcattcgattggtgatgatgttgaactgattgatgctgatgtcgatctcgccgtgttttgttcctctgcagctggacgagtgggtgctgtgccggctgtacaacaagaagaacaactgggagaaggtgaagctggagcagcaggacgtggcctccgtggcggcggcggcgccgcgcaaccaccaccatcagaacggcgaggtcatggacgcggcggcggctgacaccatgtccgacagcttccagacgcacgactccgacatcgacaacgcctccgccggcctgcggcacggtggctgcggcggcggcggcttcggcgacgtggcgccgccgaggaatgggttcgtgacggtgaaggaggacaacgactggttcaccggcctcaacttcgacgagctgcagccgccgtacatgatgaacctgcagcacatgcagatgcagatggtgaatccggcggcgccagggcacgacggcggctacttgcagtccatcagctcgccgcagatgaagatgtggcagacaatcctgccaccattctgagatggatggagcaagaaaaaggttgctgtagataaagggcggaaataggagtgatggctagaaaattattagatttactagaacgaaaatgattagaaatctggcaagcatgattctgcaaatgtggtggtagatgcttgcagtatgtaattcatttgttcagtatatgcatttggtaatctgcaaaacatctccttttgttctcatatcctaagcgaaacatatatgattttatccttc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051152.2 RefSeq:Os01g0816100]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 1]]
 
[[Category:Chromosome 1]]
 

Latest revision as of 03:17, 10 October 2016

  • OsNAC4 encodes a plant-specific transcription factor, leads to HR cell death accompanied by the loss of plasma membrane integrity, nuclear DNA fragmentation and typical morphological changes.


'Figure 1 Cell death induction by OsNAC4. (A) Cell death was induced in cultured rice cells by co-introduction of OsNAC4 gene(pAHC17-OsNAC4) or OsNAC6 (pAHC17-OsNAC6) and GUS. After transformation by particle bombardment, GUS activity in each cell was detected histochemically. The relative intensity of GUS staining is shown in the right graph. The mean values with error bars were derived from 10 independent experiments. (B) GUS activity in a rice leaf 24 h after transformation. GUS activity was measured after cointroduction of OsNAC4 (pAHC17-OsNAC4) and GUS (right) or GUS alone (left). pAHC17 was used for control experiments. The experiments were carried out in three different biological materials.(C) Protoplasts were transfected with the pAHC17 (control) or pAHC17-OsNAC4 vectors. After 12 h, protoplasts were incubated in 0.05% Evans blue for 5 min. (D) Protoplasts were transfected with pAHC17 (control) or pAHC17-OsNAC4. Twelve hours after transfection, dead protoplasts were scored using a light microscope.Values on the y-axis describe the percentage of dead cell in transfected protoplasts. Each determination was done with at least 1000 cells in each experiment. The mean values with error bars were derived from five independent experiments.


Function

  • OsNAC4 encodes a plant-specific transcription factor, leads to HR cell death accompanied by the loss of plasma membrane integrity.
  • nuclear DNA fragmentation and typical morphological changes.
  • OsNAC4 is translocated into the nucleus in a phosphorylation-dependent manner.


Labs working on this gene

  • Graduate School of Biological Sciences, Nara Institute of Science and Technology (NAIST), Takayama Ikoma, Nara, Japan
  • Graduate School of Bio-Science, Nagahama Institute of Bio-Science and Technology, Tamura Nagahama, Shiga, Japan


References

  • Alvarez ME, Pennell RI, Meijer PJ, Ishikawa A, Dixon RA, Lamb C (1998) Reactive oxygen intermediates mediate a systemic signal network in the establishment of plant immunity. Cell 92:773–784.





























Structured Information