Difference between revisions of "Os01g0909100"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
 
(8 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
Histone deacetylases (HDAC) are important in plant gene expression.  
 
+
<br>
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
*Down-regulation of HDA703 by amiRNA reduced rice peduncle elongation and fertility,while inactivation of a closely related homolog HDA710 by RNAi affected vegetative growth.
 
+
*HDA704 RNAi altered plant height and flag leaf morphology.
===Expression===
+
*Down-regulation of HDT702 led to the production of narrowed leaves and stems.  
Please input expression information here.
+
<br>
 
+
[[File:22-f1.png |center |thumb |10000px |''''''Fig. 1. Expression analysis of the rice HDAC genes. Upper: A hierarchical cluster display of relative expression levels of the rice HDAC genes in 33 samples representing different organs or tissues at different developmental stages of the Minghui 63 cultivar. 1–5: Calli at different induction stages from cultured embryos. 6: Plumule at 48 h after emergence in the dark. 7: Plumule at 48 h after emergence in the light. 8: Radical at 48 h after emergence in the dark. 9: Radical at 48 h after emergence in the light. 10: 72 himbibed seed. 11: Embryo and radicle after germination. 12: Seedling leaves and roots at three-leaf stage. 13: Shoots of seedlings with two tillers. 14: Roots of seedlings with two tillers. 15: Stem at day 5 before heading. 16: Stems at heading stage. 17: Leaves from plants at young panicle stage 3. 18: Leaves at young panicle stage 7. 19: Flag leaves at day 5 before heading. 20: Flag leaf at day 14 after heading. 21: Sheaths at young panicle stage 3. 22: Sheaths at young panicle stage 7. 23 : Hulls one day before flowering.24: Stamens one day before flowering. 25: Young panicle at stage 3. 26: Young panicles at stage 4. 27: Young panicles at stage 5. 28: Panicles at stage 7. 29: Panicles at heading stage. 30: Spikelets, 3 days after pollination. 31: Endosperm, 7 days after pollination. 32: Endosperm, 14 days after pollination. 33: Endosperm, 21 days after pollination.Lower: Expression changes of HDAC genes responding to abiotic stresses including drought, salt and cold in seven-day-old light-grown seedlings. Color bar at the base represents log2 expression values: green, representing low expression; black, medium expression; red, high expression.'''''']]
===Evolution===
+
<br>
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*National Key Laboratory for Crop Genetic Improvement, Huazhong Agricultural University, 430070 Wuhan, China
 +
*Institut de Biotechnologie des Plantes, Université Paris sud 11, 91405 Orsay, France
 +
<br>
  
 
==References==
 
==References==
Please input cited references here.
+
*'''R. Pandey, A. Muller, C.A. Napoli, D.A. Selinger, C.S. Pikaard, E.J. Richards,J. Bender, D.W. Mount, R.A. Jorgensen''' Analysis of histone acetyltransferase and histone deacetylase families of Arabidopsis thaliana suggests functional diversification of chromatin modification among multicellular eukaryotes, Nucleic Acids Res. 30 (2002) 5036–5055.
 +
<br>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
GeneName = Os01g0909100|
 
Description = Conserved hypothetical protein|
 
Version = NM_001185772.1 GI:297720678 GeneID:9272341|
 
Length = 2966 bp|
 
Definition = Oryza sativa Japonica Group Os01g0909100, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:41344121..41347086|
 
CDS = 41345973..41346230|
 
GCID = <gbrowseImage1>
 
name=NC_008394:41344121..41347086
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:41344121..41347086
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>tacactcttttatgttatctactttcagatgataagatcaaagaagttcaaaacagtccaagtaagtttgccacacttaagtctgctgctgctgcatcccctacaccagaggctattgtagaggaaagaaagaattatgggaaatcagaagctgatgatgatgacagcgatgaagaaagtgatgcttcaggcgaggatgaatatgatgatgatgaggtttgtaaaacagtaacactattaaaactagcagcatgctga</cdnaseq>|
 
AA = <aaseq>YTLLCYLLSDDKIKEVQNSPSKFATLKSAAAASPTPEAIVEERK                    NYGKSEADDDDSDEESDASGEDEYDDDEVCKTVTLLKLAAC</aaseq>|
 
DNA = <dnaseqindica>1853..2110#cactccgccgcgcggctgctctctctccctctctaaaaccctagcagaggagcacggcgaggagaggagaggagggggaaggagggagaggccacggggaacgcgatcgccttcgtgccgcccatggagacgaccatgggattctggggtgcgttcctcttgcccccgaaccctactactgtttctcgctcccgattcgacgccatctttaattttttttggtcgcgcctagtcgataggggaaattttgaggggtaaaaatggtgtggtggattgttgatcctcggtttcttggttaaatgctgggtttccccccatatgctccggagatctggggatattttcaccggcaatgcttcctgataggatgcggtggtattttggtgtatttgggggagaaatagaagcaatattcgtgtaggaaaatgcagtcatacccttgaactttaatcaggctcttggcagaactgcaggaaatttggctattccattgatgagttggattcaagtgaacaagttgatatctaggagtaataaggcagtagtttgtcttaatgaactgtgccttgctctggagagtaatacattccctgcttctgtttggtggttcctggatttagtatagtttgtattttcatgttatggttggatgatttagtgcttcagtttttttaatgaattaagcatggcatgaagcttactggagagtgttgactggcaaggtcgatgttgattggtcaatctttgatttttcaggtcttcatgattgactatggtttcttcttgcccatgtagatatgaaatatttatcactgaaatacgcgcattcttctacttatatttgccttcgattatgcgttgtacttattctgaacacaagtgtggcattcaaactgcccgttggcatgccactaatgttttttcccctctgtgtcaactgtgaagagatcttttgatcgcgttggacacaagcgtgatgggcatatttgtagagcttaagaaagaagcaaatgtttgtcattcccaatttcacgtgttgctcatttttaccaatgtttactaatggctttcatgaatgtaattcacatttctaggagttgctgtcagacctggagagacagtgatgtgtgatccaccaggagaattctattatcatatttcacaggtttgtttaacaaattgtacctaaaagctcatttggaggtggatcaagtttgtttactttaagttcccattttcactgcagatagcgttagagcctggtgagctgaatgagaacgtgcaagtttttggtgaagttgatggtaaaaggattctgctcggcacactttcagttgaacatcgtcctcagttgtcaattgatctggtgtttgaaaaggagtttgagttactgcatacctcaaagacctacaacatcttcttttctggctaccaagctgcggatgcgagaagatatccttttgcatttataatgatctttcttcaaataaatcatgagtaggaatatttttccttaaccttttgcctggctgtatgcacatctgactctcctactgaagaaggtatgtgtccttgttctttactagtagtaattggtcatctctgatgtttccgctgcacttggcctgattctcataagatgtgatgtttcaggtgatgaatctgatgaggaggttccactggctattccactattccccaattcagatggtatataatttgctaatcgtaacaattattttataagacttaagaagatagcatggtaattgaacttataagactttatatatttttacgctagaatctgatgcacatgctaatacaagctggtaagcgaatcttcgaatgatacactcttttatgttatctactttcagatgataagatcaaagaagttcaaaacagtccaagtaagtttgccacacttaagtctgctgctgctgcatcccctacaccagaggctattgtagaggaaagaaagaattatgggaaatcagaagctgatgatgatgacagcgatgaagaaagtgatgcttcaggcgaggatgaatatgatgatgatgaggtttgtaaaacagtaacactattaaaactagcagcatgctgattcttgttcagactgaaaccatgacatggttttggacttcggtaggtgtgcgaacaaagttttctttatgctagatatgttatgatcatgcgatatatttgtaggatatgattgataaacaggattctagtgatgatgatggtgatagttcggatgaagaagagactccttcaaaggtgtgagcttgttcaaggctagcaaccccaattatggacagcaaagctggtcggaaactgtttcttttgatttgttttcccccctaaattcactgttttttttatggcacagagattgcatttctcacttgtagatcttgtgtgcaggaactggcaagagaagtggctacgtccatgtcgcgactccttatccagcaaaacaggcaaagaagacacctgtaaacaatgacatggctaagcaatcctctggctatgtccacgttgcgaccccttatccagcaaaacaggcaaagaagaggactgccaataatgacatgtctgagcattctgctggttatgcctgcaagccatgcaacaagtaaatttttgttcttttcatttgaatgatttaccttagtaatgctgctatatcctcacatatgcacttcctattttgctcaggactttcaacacctctatgggtctggaagctcattccaaggcgaaacacactgcaactaagtgatctgaaataccttctgggcaatcctgtgtaggtgtgttagtgataggtaactgaattctgaagctggagatccagatattttgatgaagcacaattttggagcacttgccaagtttctgaaacatgtagatatatggcgcttttttaatgaatgcgtatggatgttgcacgtttc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001185772.1 RefSeq:Os01g0909100]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 1]]
 
[[Category:Chromosome 1]]
 

Latest revision as of 03:35, 10 October 2016

Histone deacetylases (HDAC) are important in plant gene expression.

Annotated Information

Function

  • Down-regulation of HDA703 by amiRNA reduced rice peduncle elongation and fertility,while inactivation of a closely related homolog HDA710 by RNAi affected vegetative growth.
  • HDA704 RNAi altered plant height and flag leaf morphology.
  • Down-regulation of HDT702 led to the production of narrowed leaves and stems.


'Fig. 1. Expression analysis of the rice HDAC genes. Upper: A hierarchical cluster display of relative expression levels of the rice HDAC genes in 33 samples representing different organs or tissues at different developmental stages of the Minghui 63 cultivar. 1–5: Calli at different induction stages from cultured embryos. 6: Plumule at 48 h after emergence in the dark. 7: Plumule at 48 h after emergence in the light. 8: Radical at 48 h after emergence in the dark. 9: Radical at 48 h after emergence in the light. 10: 72 himbibed seed. 11: Embryo and radicle after germination. 12: Seedling leaves and roots at three-leaf stage. 13: Shoots of seedlings with two tillers. 14: Roots of seedlings with two tillers. 15: Stem at day 5 before heading. 16: Stems at heading stage. 17: Leaves from plants at young panicle stage 3. 18: Leaves at young panicle stage 7. 19: Flag leaves at day 5 before heading. 20: Flag leaf at day 14 after heading. 21: Sheaths at young panicle stage 3. 22: Sheaths at young panicle stage 7. 23 : Hulls one day before flowering.24: Stamens one day before flowering. 25: Young panicle at stage 3. 26: Young panicles at stage 4. 27: Young panicles at stage 5. 28: Panicles at stage 7. 29: Panicles at heading stage. 30: Spikelets, 3 days after pollination. 31: Endosperm, 7 days after pollination. 32: Endosperm, 14 days after pollination. 33: Endosperm, 21 days after pollination.Lower: Expression changes of HDAC genes responding to abiotic stresses including drought, salt and cold in seven-day-old light-grown seedlings. Color bar at the base represents log2 expression values: green, representing low expression; black, medium expression; red, high expression.'


Labs working on this gene

  • National Key Laboratory for Crop Genetic Improvement, Huazhong Agricultural University, 430070 Wuhan, China
  • Institut de Biotechnologie des Plantes, Université Paris sud 11, 91405 Orsay, France


References

  • R. Pandey, A. Muller, C.A. Napoli, D.A. Selinger, C.S. Pikaard, E.J. Richards,J. Bender, D.W. Mount, R.A. Jorgensen Analysis of histone acetyltransferase and histone deacetylase families of Arabidopsis thaliana suggests functional diversification of chromatin modification among multicellular eukaryotes, Nucleic Acids Res. 30 (2002) 5036–5055.


Structured Information