Difference between revisions of "Os10g0409400"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os10g0409400| Description = Similar to Polygalacturonase isoenzyme 1 beta subunit precursor| Version = NM_001071107.1 GI:115481957 GeneID:4348595...")
 
(References)
 
(6 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os10g0409400''''' was reported as '''''OsBURP16''''' in 2014 <ref name="ref1" /> by researchers from China.  
GeneName = Os10g0409400|
 
Description = Similar to Polygalacturonase isoenzyme 1 beta subunit precursor|
 
Version = NM_001071107.1 GI:115481957 GeneID:4348595|
 
Length = 1542 bp|
 
Definition = Oryza sativa Japonica Group Os10g0409400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
==Annotated Information==
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
===Function===
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
* Polygalacturonase (PG), one of the hydrolases responsible for cell wall pectin degradation, is involved in organ consenescence and biotic stress in plants.
|
+
* '''''OsBURP16''''' belongs to the PG1β-like subfamily of BURP- family genes and encodes one putative PG1β subunit precursor in rice (Oryza sativa L.).
Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|
+
* Overexpression of '''''OsBURP16''''' caused pectin degradation and affected cell wall integrity as well as transpiration rate, which decreased tolerance to abiotic stresses.
AP = Chromosome 10:14528731..14530272|
+
 
CDS = 14528879..14529183,14529506..14530235|
+
===Phenotypic analysis===
GCID = <gbrowseImage1>
+
* Analysis of plant survival rates, relative ion leakage rates, accumulation levels of H2O2 and water loss rates of leaves showed that overexpression of '''''OsBURP16''''' enhanced sensitivity to cold, salinity and drought stresses compared with controls.
name=NC_008403:14528731..14530272
+
* Young leaves of Ubi::OsBURP16 transgenic plants showed reduced cell adhesion and increased cuticular transpiration rate.
source=RiceChromosome10
+
* Mechanical strength measurement of '''''Ubi::OsBURP16''''' plants showed that reduced force was required to break leaves as compared with wild type.
preset=GeneLocation
+
* Transgenic rice showed enhanced PG activity and reduced pectin content.
</gbrowseImage1>|
+
<br>
GSID = <gbrowseImage2>
+
[[File:59-Os10g0409400.png|center|thumb|727px|'''Figure 2.''' ''Generation of Ubi::OsBURP16 transgenic rice..<ref name="ref1" />.'']]
name=NC_008403:14528731..14530272
+
 
source=RiceChromosome10
+
===Expression===
preset=GeneLocation
+
* RT-PCR (qRT-PCR) assays showed '''''OsBURP16''''' was expressed in various tissues, mainly in leaf lamina, leaf cushion and internodes (Fig. 1c). These results show that OsBURP16 is highly expressed in young leaves.
</gbrowseImage2>|
+
* Transcription of '''''OsBURP16''''' is induced by cold, salinity and drought stresses, as well as by abscisic acid (ABA) treatment.
CDNA = <cdnaseq>atggcaacatcctttctcttctctctcattctcctcctcatcactgccctttctcttccctttcctctccatgcgtcatctgtagaccccttgagcgccggtgcgaccaccgtccgctactggaatcgcaagattcctaacaatgctcctcaccccgacttcttcctttcactcctctcccctcttcccgcatctgtctcctcttccctctcctctccgctctccatatccccatccatctgccgctctgctcgcctcctctgccctaactctacctattttcagtccctctcaagcactgtcttcatagatggatgcacctttagttactcatgcaccttcacatacgaacataccaacatcactataaagcctggtatattttttcgggagcaagaattgaaagaggggaatgtggtcagaatgccagatatagcgaatgagttgacgacggctcgttcgtcgttccttccccgatcgatcgcggataggatcccattcaaggctgaggctgtcaagtccctgttcgggctagagccaaacacaaccttggcaaaggctgtggatgaaacggtggcgcaatgccagagctcgccaagcaagggcgagacgaagcggtgcgtcacatcagcagaggacatgatcgactttgccgtggcgatgttaggtgatgacattgtggttcggagtaccgtactgccaaatgggcccggcgagtcgatcatgattggtaaggtcaagggaataaatggtggcaagattaccagctcggtatcatgccacgaatacttatttccatacatggtatactactgccactcggtgcctaaaatcagagtttatgaggccgagatcctgtccgtccagacgaaggagaagatcaacagcggtgtcgccatctgtcacattgacacgtctgcctggaatgctgggcatcctgcttttgtggcactaggtgggaagccaggtcagaacaaggtctgccactggatatttaatggctctatgacctgggtcatcgccgacaaatcctaa</cdnaseq>|
+
 
AA = <aaseq>MATSFLFSLILLLITALSLPFPLHASSVDPLSAGATTVRYWNRK                    IPNNAPHPDFFLSLLSPLPASVSSSLSSPLSISPSICRSARLLCPNSTYFQSLSSTVF                    IDGCTFSYSCTFTYEHTNITIKPGIFFREQELKEGNVVRMPDIANELTTARSSFLPRS                    IADRIPFKAEAVKSLFGLEPNTTLAKAVDETVAQCQSSPSKGETKRCVTSAEDMIDFA                    VAMLGDDIVVRSTVLPNGPGESIMIGKVKGINGGKITSSVSCHEYLFPYMVYYCHSVP                    KIRVYEAEILSVQTKEKINSGVAICHIDTSAWNAGHPAFVALGGKPGQNKVCHWIFNG                    SMTWVIADKS</aaseq>|
+
You can also add sub-section(s) at will.
DNA = <dnaseqindica>1090..1394#38..767#acttgtctttccagcacagctagcattctaccaaccaatggcaacatcctttctcttctctctcattctcctcctcatcactgccctttctcttccctttcctctccatgcgtcatctgtagaccccttgagcgccggtgcgaccaccgtccgctactggaatcgcaagattcctaacaatgctcctcaccccgacttcttcctttcactcctctcccctcttcccgcatctgtctcctcttccctctcctctccgctctccatatccccatccatctgccgctctgctcgcctcctctgccctaactctacctattttcagtccctctcaagcactgtcttcatagatggatgcacctttagttactcatgcaccttcacatacgaacataccaacatcactataaagcctggtatattttttcgggagcaagaattgaaagaggggaatgtggtcagaatgccagatatagcgaatgagttgacgacggctcgttcgtcgttccttccccgatcgatcgcggataggatcccattcaaggctgaggctgtcaagtccctgttcgggctagagccaaacacaaccttggcaaaggctgtggatgaaacggtggcgcaatgccagagctcgccaagcaagggcgagacgaagcggtgcgtcacatcagcagaggacatgatcgactttgccgtggcgatgttaggtgatgacattgtggttcggagtaccgtactgccaaatgggcccggcgagtcgatcatgattggtaagctatgatattaattagagttgcaagcatcctatagagtgtagctatccagtgtcaactagttaagtggcgcacttgtattcataggaaatagaattaaattaaattctagctagtgaaaaccagaataacctaacctcctacattattatacctgtatatatatatatagttttcgtgttggaacggggcaagaaggtataaccaggcatatttgtgtaaaatgaaaggctggcttacaacagttaattatctaatacagtaatactaatatagtggatatataatttttgattttgttcatttgttatatatgtaggtaaggtcaagggaataaatggtggcaagattaccagctcggtatcatgccacgaatacttatttccatacatggtatactactgccactcggtgcctaaaatcagagtttatgaggccgagatcctgtccgtccagacgaaggagaagatcaacagcggtgtcgccatctgtcacattgacacgtctgcctggaatgctgggcatcctgcttttgtggcactaggtgggaagccaggtcagaacaaggtctgccactggatatttaatggctctatgacctgggtcatcgccgacaaatcctaattacacacacgtttcgatctgaatcgatgaaccatatatatatgcagcatcagacctatcttagtatatattgctggtctgctactgcacttctccagtgcgatgtatccgtgtgttttcaatataaataaatataaagtaattttat</dnaseqindica>|
+
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001071107.1 RefSeq:Os10g0409400]|
+
==Labs working on this gene==
}}
+
* Key Laboratory of Plant Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, Beijing 100093, China
[[Category:Genes]]
+
* Graduate University of the Chinese Academy of Sciences, Beijing 100049, China
[[Category:Japonica mRNA]]
+
 
[[Category:Oryza Sativa Japonica Group]]
+
==References==
[[Category:Japonica Genes]]
+
<references>
[[Category:Japonica Chromosome 10]]
+
* <ref name="ref1">
[[Category:Chromosome 10]]
+
Liu H, Ma Y, Chen N, Guo S, Liu H, Guo X, Chong K, Xu Y. Overexpression of
 +
stress-inducible OsBURP16, the β subunit of polygalacturonase 1, decreases pectin
 +
content and cell adhesion and increases abiotic stress sensitivity in rice. Plant
 +
Cell Environ. 2014 May;37(5):1144-58. doi: 10.1111/pce.12223. Epub 2013 Nov 26.
 +
PubMed PMID: 24237159
 +
</ref>
 +
 
 +
</references>
 +
 
 +
==Structured Information==
 +
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 10]]

Latest revision as of 09:41, 12 October 2016

The rice Os10g0409400 was reported as OsBURP16 in 2014 [1] by researchers from China.


Annotated Information

Function

  • Polygalacturonase (PG), one of the hydrolases responsible for cell wall pectin degradation, is involved in organ consenescence and biotic stress in plants.
  • OsBURP16 belongs to the PG1β-like subfamily of BURP- family genes and encodes one putative PG1β subunit precursor in rice (Oryza sativa L.).
  • Overexpression of OsBURP16 caused pectin degradation and affected cell wall integrity as well as transpiration rate, which decreased tolerance to abiotic stresses.

Phenotypic analysis

  • Analysis of plant survival rates, relative ion leakage rates, accumulation levels of H2O2 and water loss rates of leaves showed that overexpression of OsBURP16 enhanced sensitivity to cold, salinity and drought stresses compared with controls.
  • Young leaves of Ubi::OsBURP16 transgenic plants showed reduced cell adhesion and increased cuticular transpiration rate.
  • Mechanical strength measurement of Ubi::OsBURP16 plants showed that reduced force was required to break leaves as compared with wild type.
  • Transgenic rice showed enhanced PG activity and reduced pectin content.


Figure 2. Generation of Ubi::OsBURP16 transgenic rice..[1].

Expression

  • RT-PCR (qRT-PCR) assays showed OsBURP16 was expressed in various tissues, mainly in leaf lamina, leaf cushion and internodes (Fig. 1c). These results show that OsBURP16 is highly expressed in young leaves.
  • Transcription of OsBURP16 is induced by cold, salinity and drought stresses, as well as by abscisic acid (ABA) treatment.

You can also add sub-section(s) at will.

Labs working on this gene

  • Key Laboratory of Plant Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, Beijing 100093, China
  • Graduate University of the Chinese Academy of Sciences, Beijing 100049, China

References

  1. 1.0 1.1 Liu H, Ma Y, Chen N, Guo S, Liu H, Guo X, Chong K, Xu Y. Overexpression of stress-inducible OsBURP16, the β subunit of polygalacturonase 1, decreases pectin content and cell adhesion and increases abiotic stress sensitivity in rice. Plant Cell Environ. 2014 May;37(5):1144-58. doi: 10.1111/pce.12223. Epub 2013 Nov 26. PubMed PMID: 24237159

Structured Information