Difference between revisions of "Os01g0749200"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os01g0749200| Description = Similar to 50S ribosomal protein L13| Version = NM_001050781.1 GI:115439932 GeneID:4325555| Length = 2356 bp| Defin...")
 
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os01g0749200''''' was reported as '''''WLP1''''' in 2014 <ref name="ref1" /> by researchers from China.  
GeneName = Os01g0749200|
 
Description = Similar to 50S ribosomal protein L13|
 
Version = NM_001050781.1 GI:115439932 GeneID:4325555|
 
Length = 2356 bp|
 
Definition = Oryza sativa Japonica Group Os01g0749200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
[[File:63-Os01g0749200.png|right|thumb|427px|'''Fig. 1.'''Phenotypic characterization of the wlp1 mutants.<ref name="ref1" />.'']]
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
===Gene Symbol===
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
*'''''Os01g0749200''''' '''''<=>''''' '''''WLP1''''','''''OsWLP1'''''
|
+
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
+
===Function===
AP = Chromosome 1:33122903..33125258|
+
* The rice '''''WLP1''''' encodes a chloroplast ribosome L13 protein.
CDS = 33122998..33123222,33123784..33123969,33124251..33124421,33124895..33125014|
+
* '''''WLP1''''' is required for normal chloroplast development, especially under low temperature conditions. This is the first report on the function of PRPs in rice.
GCID = <gbrowseImage1>
+
 
name=NC_008394:33122903..33125258
+
===Phenotypic analysis===
source=RiceChromosome01
+
* Under Hangzhou field conditions, wlp1 seedlings younger than the four-leaf stage (L4) produced albino leaves (Fig.  1a), but these became green from L4 onwards (Fig. 1b). The immature wlp1 panicle was not fully green at heading (Fig. 1c, d). The mutant flowered slightly later and was taller than the wild type (ESM Table S4).  
preset=GeneLocation
+
* The albino phenotype was more strongly expressed under low temperature conditions, with mutant seedlings exposed to 23 °C being severely albino at the two-leaf (L2) and three-leaf stages (L3) (Fig. 1e). In contrast, under the 25 °C condition, the phenotype was much milder (Fig. 1f), and under the 30 °C condition, there was little discernible difference in the appearance of the mutant and the wild type (Fig. 1g).
</gbrowseImage1>|
+
* The bleached panicle trait was also exacerbated by lower temperatures (ESM Fig. S1). Under Hangzhou field conditions, the leaves of L3 seedlings and immature panicles of wlp1 displayed a substantial deficiency in chlorophyll a (Chl a), Chl b and total chlorophyll content, while the pig- ment content of L4 and later leaves was normal (Fig. 2a–c).
GSID = <gbrowseImage2>
+
* Exposure to 23 °C induced a substantial reduction in the pigment content of the mutant’s tissues (Fig. 2d), while exposure to 25 °C suppressed only chlorophyll b content (Fig. 2e) and exposure to 30 °C had no effect at all on chlorophyll content (Fig. 2f). Analysis of the rates of chlorophyll accumulation under the 23 °C condition revealed that the rate of chlorophyll accumulation had slowed in the wlp1 mutant.
name=NC_008394:33122903..33125258
+
===Expression===
source=RiceChromosome01
+
* In plants grown in the Hangzhou fields, '''''WLP1''''' was transcribed in the leaf, leaf sheath, culm, immature panicle, and root. Transcript abundance was higher in the leaf, leaf sheath, and immature panicle than in either the culm or the root
preset=GeneLocation
+
 
</gbrowseImage2>|
+
===Subcellular localization===
CDNA = <cdnaseq>atggctacggccatcgcagcctccgcgttcctctcctccgccttcgccagggacaggccgctcccccgccagcggcgcgcggcgaggcccgcgacccgccgcgccgccgcggggggcctgtcggtgcggtgcgagcagagcgagaagcagaagaggcagccgctctccgcgctcgtcccccgcgagcagcgattcatgttcgaaggcgacgagctctgcggccccgacatatggaacacaacatggtaccctaaggctgcagatcatgtaactactgagaagacatggtatgttgttgatgcaacagacaagattctaggtaggcttgcatccaccattgcagtacacatcagaggaaagaatgaggccacatacactccaagtgtggacatgggggcttttgttgttgtggttaatgcagagaaggttgctgtttctggcaaaaagcggtcacagaagctctacaggaggcactctggacggcctggtggaatgaaagaagaaacttttgatcagcttcagaaaaggattccggagagaattattgaacatgcagtgcgtggcatgcttcctaagggcagactgggaagaagactgtttacccacctcaaggtgtacaagggagcagaacatccccatgaggctcaaaaacctgttccactgcctatcaaggataaaagaatacagaagtctgagaagtag</cdnaseq>|
+
* '''''WLP1''''' was localized in the chloroplast
AA = <aaseq>MATAIAASAFLSSAFARDRPLPRQRRAARPATRRAAAGGLSVRC                    EQSEKQKRQPLSALVPREQRFMFEGDELCGPDIWNTTWYPKAADHVTTEKTWYVVDAT                    DKILGRLASTIAVHIRGKNEATYTPSVDMGAFVVVVNAEKVAVSGKKRSQKLYRRHSG                    RPGGMKEETFDQLQKRIPERIIEHAVRGMLPKGRLGRRLFTHLKVYKGAEHPHEAQKP                    VPLPIKDKRIQKSEK</aaseq>|
+
 
DNA = <dnaseqindica>96..320#882..1067#1349..1519#1993..2112#gaaacgaaatggcagtggcgttccactgaaccaggccaagccagacggacaagacttcgccgcagccgcgtcctcctcaccgcgccgccgtcgcaatggctacggccatcgcagcctccgcgttcctctcctccgccttcgccagggacaggccgctcccccgccagcggcgcgcggcgaggcccgcgacccgccgcgccgccgcggggggcctgtcggtgcggtgcgagcagagcgagaagcagaagaggcagccgctctccgcgctcgtcccccgcgagcagcgattcatgttcgaaggcgacgagctctgcggccccgtactaaccctcacctctctttctctctcccgtatacattcttctctttctcagttcagaaaatgaatagtaatgctacattccttggataaagggaaattttaccgtgatttaggattgccgcttatttaggaaagctcaagattagtcccattcatttctaaatccgtaagtcacttcatcttgctctattgggtcaaatcctttctttacatgaataatgttagggaaaatacacaatgtttttacatgttactataccgtatagaccaccatcttattttatttaaagttatctagttgtaatttattacgaaagaggattccataaaatgaactgaaaataacatggagggaacgttggtctttctgaattggtcgctaacattgtgttgtattactcaacagtgttcgcacctacatgactaccatatctttttatctgtggatgtttaggtttgtgaagttagaattcagtacggataccattcttgtgttctttctctcttttctgtgcaacctgttctgtgtagtgatcggaccaaggaatttaatttgcaggacatatggaacacaacatggtaccctaaggctgcagatcatgtaactactgagaagacatggtatgttgttgatgcaacagacaagattctaggtaggcttgcatccaccattgcagtacacatcagaggaaagaatgaggccacatacactccaagtgtggacatgggggcttttgttgttgtggtatgtatgtttcttgaaattaatttataaagttaaatagtgcacacaataagatcctctgtagtcccacaaaaggaaaagaggtttagcagcacatacaaataagcaccaaaaggtatctggaagctgaggtccacctgaaggcattttgaagctgatttcatgtatatatatttatgttactgtgtgcttttaatactaatgcatctctgaagagtaattgctacgcatatactattgtaagttcctgaactaccatgctgaactctatgttcacataggttaatgcagagaaggttgctgtttctggcaaaaagcggtcacagaagctctacaggaggcactctggacggcctggtggaatgaaagaagaaacttttgatcagcttcagaaaaggattccggagagaattattgaacatgcagtgcgtggcatgcttcctaagggcagagtaagacatcatctcttagagctcttatctagtcagtttcatcaagtctttttgaccttaagtcagcctacctgggtatacatatgctcttatccttatttttggtcaatttctaatacatatctgaaaatgggtatcctcgttctgttccattatacttcattattgtgtataattccccaactttatataccctgttcatggaaatattcgctctaattgaatgccgaaacggcgtgggctaacgaagtactagatgtattctcccaaaactcctatgttgcctgtaagacatcttatgattgcctaaagccttttacttatgcctaagttcatttataaaaaaaaaaaacgtttactatgtcaacctctcaagttctcatatgttagtgacactgacacatgtaatccgaccaactacagcggttgtacgtgctctatgtagccttctcaacattttgaacattttgcagctgggaagaagactgtttacccacctcaaggtgtacaagggagcagaacatccccatgaggctcaaaaacctgttccactgcctatcaaggataaaagaatacagaagtctgagaagtagataattcctgtggagactaagaaagacacaacaatctcacgtaaattcctcccctcgagattttgtccaatctttggaatgtgatgcatctgtctgtttggggaatggagtgtaaaattttttgtaatttacttcctccaaaagtttgtgtttctaagtcatagttcttgttgattacatatcatgtacctaataccgtacgattttaagcaatccgatatttccatatccaattgagtagtgc</dnaseqindica>|
+
You can also add sub-section(s) at will.
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050781.1 RefSeq:Os01g0749200]|
+
 
}}
+
==Labs working on this gene==
[[Category:Genes]]
+
* State Key Laboratory of Rice Biology, Key Laboratory of Rice Biology and Breeding of Ministry of Agriculture, China National Rice Research Institute, Hangzhou 310006, China
[[Category:Japonica mRNA]]
+
* Zhengzhou Fruit Research Institute, Chinese Academy of Agricultural Sciences, Zhengzhou 450009, China
[[Category:Oryza Sativa Japonica Group]]
+
==References==
[[Category:Japonica Genes]]
+
<references>
[[Category:Japonica Chromosome 1]]
+
* <ref name="ref1">
[[Category:Chromosome 1]]
+
Song J, Wei X, Shao G, Sheng Z, Chen D, Liu C, Jiao G, Xie L, Tang S, Hu P.
 +
The rice nuclear gene WLP1 encoding a chloroplast ribosome L13 protein is needed
 +
for chloroplast development in rice grown under low temperature conditions. Plant
 +
Mol Biol. 2014 Feb;84(3):301-14. doi: 10.1007/s11103-013-0134-0. Epub 2013 Oct
 +
15. PubMed PMID: 24132771.
 +
</ref>
 +
</references>
 +
 
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]

Latest revision as of 15:24, 13 October 2016

The rice Os01g0749200 was reported as WLP1 in 2014 [1] by researchers from China.

Annotated Information

Fig. 1.Phenotypic characterization of the wlp1 mutants.[1].

Gene Symbol

  • Os01g0749200 <=> WLP1,OsWLP1

Function

  • The rice WLP1 encodes a chloroplast ribosome L13 protein.
  • WLP1 is required for normal chloroplast development, especially under low temperature conditions. This is the first report on the function of PRPs in rice.

Phenotypic analysis

  • Under Hangzhou field conditions, wlp1 seedlings younger than the four-leaf stage (L4) produced albino leaves (Fig. 1a), but these became green from L4 onwards (Fig. 1b). The immature wlp1 panicle was not fully green at heading (Fig. 1c, d). The mutant flowered slightly later and was taller than the wild type (ESM Table S4).
  • The albino phenotype was more strongly expressed under low temperature conditions, with mutant seedlings exposed to 23 °C being severely albino at the two-leaf (L2) and three-leaf stages (L3) (Fig. 1e). In contrast, under the 25 °C condition, the phenotype was much milder (Fig. 1f), and under the 30 °C condition, there was little discernible difference in the appearance of the mutant and the wild type (Fig. 1g).
  • The bleached panicle trait was also exacerbated by lower temperatures (ESM Fig. S1). Under Hangzhou field conditions, the leaves of L3 seedlings and immature panicles of wlp1 displayed a substantial deficiency in chlorophyll a (Chl a), Chl b and total chlorophyll content, while the pig- ment content of L4 and later leaves was normal (Fig. 2a–c).
  • Exposure to 23 °C induced a substantial reduction in the pigment content of the mutant’s tissues (Fig. 2d), while exposure to 25 °C suppressed only chlorophyll b content (Fig. 2e) and exposure to 30 °C had no effect at all on chlorophyll content (Fig. 2f). Analysis of the rates of chlorophyll accumulation under the 23 °C condition revealed that the rate of chlorophyll accumulation had slowed in the wlp1 mutant.

Expression

  • In plants grown in the Hangzhou fields, WLP1 was transcribed in the leaf, leaf sheath, culm, immature panicle, and root. Transcript abundance was higher in the leaf, leaf sheath, and immature panicle than in either the culm or the root

Subcellular localization

  • WLP1 was localized in the chloroplast

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Rice Biology, Key Laboratory of Rice Biology and Breeding of Ministry of Agriculture, China National Rice Research Institute, Hangzhou 310006, China
  • Zhengzhou Fruit Research Institute, Chinese Academy of Agricultural Sciences, Zhengzhou 450009, China

References

  1. 1.0 1.1 Song J, Wei X, Shao G, Sheng Z, Chen D, Liu C, Jiao G, Xie L, Tang S, Hu P. The rice nuclear gene WLP1 encoding a chloroplast ribosome L13 protein is needed for chloroplast development in rice grown under low temperature conditions. Plant Mol Biol. 2014 Feb;84(3):301-14. doi: 10.1007/s11103-013-0134-0. Epub 2013 Oct 15. PubMed PMID: 24132771.


Structured Information