|
|
| (4 intermediate revisions by 2 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os02g0202200''''' was reported as '''''SPX2''''' in 2014 <ref name="ref1" /> by researchers from China. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | [[File:Os02g0202200.png|right|thumb|227px|'''Fig. 2.'''Subcellular localization of full-length and deletion derivatives of SPX2 in rice protoplasts.<ref name="ref1" />.'']] |
| | + | ===Gene Symbol=== |
| | + | *'''''Os02g0202200''''' '''''<=>''''' '''''SPX2''''','''''OsSPX2''''' |
| | + | |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| + | * '''''SPX2''''' is Pi-dependent inhibitors of the activity of OsPHR2 in rice. |
| | + | * '''''SPX1''''' and '''''SPX2''''' proteins interact with PHR2 through their SPX domain, inhibiting its binding to P1BS (the PHR1-binding sequence: GNATATNC) |
| | + | * '''''SPX2''''' is critical for repressing PHR2 binding to cis ele-ments by protein interaction |
| | | | |
| − | ===Expression=== | + | ===Subcellular localization=== |
| − | Please input expression information here.
| + | * Subcellular localization analysis demonstrated that '''''SPX2''''' was mainly localized in the nucleus. |
| − | | |
| − | ===Evolution===
| |
| − | Please input evolution information here.
| |
| | | | |
| | You can also add sub-section(s) at will. | | You can also add sub-section(s) at will. |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | * State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou 310058, China |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | <references> |
| | + | * <ref name="ref1"> |
| | + | Wang Z, Ruan W, Shi J, Zhang L, Xiang D, Yang C, Li C, Wu Z, Liu Y, Yu Y, Shou |
| | + | H, Mo X, Mao C, Wu P. Rice SPX1 and SPX2 inhibit phosphate starvation responses |
| | + | through interacting with PHR2 in a phosphate-dependent manner. Proc Natl Acad Sci |
| | + | U S A. 2014 Oct 14;111(41):14953-8. doi: 10.1073/pnas.1404680111. Epub 2014 Sep |
| | + | 30. PubMed PMID: 25271318; PubMed Central PMCID: PMC4205599. |
| | + | </ref> |
| | + | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]] |
| − | GeneName = Os02g0202200|
| |
| − | Description = SPX, N-terminal domain containing protein|
| |
| − | Version = NM_001052763.1 GI:115444896 GeneID:4328654|
| |
| − | Length = 2484 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os02g0202200, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
| |
| − | AP = Chromosome 2:5706636..5709119|
| |
| − | CDS = 5706714..5707013,5707100..5707217,5708329..5708753|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008395:5706636..5709119
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008395:5706636..5709119
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgaagttcggcaagagcctgagcagccagatcgtggagatgcagccggagtggcgcgacaacttcctctcctacaaggacctcaagaagcgcctcaacctcatctccggcggcgccgccggggagagggcgagcaagcggcgtcgcgtcggtggcgcgacggcggtgacggtgacggcggcggcggcgggcgggatgacgctggagcaggccgggttcgtcggcctcctcgacgccgagctcgacaagttcaacttcttcttcctcgagaaggaggaggagtacgtcatcaagcagaaggagctccgggagaggaagatggcatcggcggaggaggtgatgcgcgtgaggaaggagatcgtcgatctccacggcgagatggtgctgctcgagaattacagcgcgctcaactacaccggattggttaaaatcctcaagaagtacgacaagagaaccggctccatgatccgtctccccttcgtccagaaggtgctgcagcaacccttcttcaccaccgacctcctctacaagctcgtgaaggaatgcgaggagatgctggaccagctcatgccgacgaacgaacactcggtagcgagcgaagatgggaaagatgacagcgaaggggaggagaagggttcaaagcccagctcctcctcctcggccaacggtggagccgtcccgggagaggccgaggccgaggatgagaggagcacggacatgaagagcaccgtcacggcggcgctcagggcgctgagagagatccggagcgggagctcgacggtgagcgtcttctccctgccgcctctgcacggcagcaatgggcaggatgaaccggggaggtga</cdnaseq>|
| |
| − | AA = <aaseq>MKFGKSLSSQIVEMQPEWRDNFLSYKDLKKRLNLISGGAAGERA SKRRRVGGATAVTVTAAAAGGMTLEQAGFVGLLDAELDKFNFFFLEKEEEYVIKQKEL RERKMASAEEVMRVRKEIVDLHGEMVLLENYSALNYTGLVKILKKYDKRTGSMIRLPF VQKVLQQPFFTTDLLYKLVKECEEMLDQLMPTNEHSVASEDGKDDSEGEEKGSKPSSS SSANGGAVPGEAEAEDERSTDMKSTVTAALRALREIRSGSSTVSVFSLPPLHGSNGQD EPGR</aaseq>|
| |
| − | DNA = <dnaseqindica>79..378#465..582#1694..2118#aatttccatttccccctcgatcccacacaattcgatcccaatttccggttttcgtgtgtgaatcttttggagagatcgatgaagttcggcaagagcctgagcagccagatcgtggagatgcagccggagtggcgcgacaacttcctctcctacaaggacctcaagaagcgcctcaacctcatctccggcggcgccgccggggagagggcgagcaagcggcgtcgcgtcggtggcgcgacggcggtgacggtgacggcggcggcggcgggcgggatgacgctggagcaggccgggttcgtcggcctcctcgacgccgagctcgacaagttcaacttcttcttcctcgagaaggaggaggagtacgtcatcaagcagaaggtaaaaattcgaattcctccgtgttccccttcgcgcttcgcgttcgtcgctgttcctgattggttccgacgacggggcgcgcgcaggagctccgggagaggaagatggcatcggcggaggaggtgatgcgcgtgaggaaggagatcgtcgatctccacggcgagatggtgctgctcgagaattacagcgcgctcaactacaccggtgagccgcccacactctgaatttttctcactgaaatttgcagcagtttatataattttcagagtttttgtactatccatgccaggtgctatcgcgtactgtattcgtgaaatggcacttcacatgatataaacatggctagttttactttcttttttttttctactgtagttcttaggacacatgggaattgaagctgttggggcctgcatttgtgtggtttttgtcacgacgcagcatttttttgtgtgattttttttgtcaggatgtgtgaataggtgaagctgataagttttgtgagtcagtagtacaatttggaacccatataattcgtctaaacggttaaacgaattctaacttttcagactgaatccatatagtccataaaatcggagtaggatagaaacaccagtaaaaaaccaggacacgtggacccatggtgggtgccgcctgtccttttcagaaaggtcaagtttcctgaaaaggggccagtcaattgtttaatatcattttatgggacatcaagcgtgcgtgctgataaaaataagtgtggtgcccactaaactatgttagataagacatgttttccataaagaaatcttggagttgaaaactcgctgacttttataggaccacgtgggccatggcactctactttttgtagttagatgtttttctattactataaaatgtataaacttgttctagcatatttttaatgggagggaccaataaaaaatgtcttttcctttgtgggatcttggattcgtcattttgttgtgagaaacatacttgcactccctaaggaaggaaatatttatcgcttcatgccgttgaaatgacttgcacctatttctttttagctgttggaaacgacagaaaattgtgaccggagggagtataatattacactttctataacttttacatctgatgatgcctataacaatgttataatattccgcagatttttggcttaaattaccggcatttctagcttgatatgcttgctgttatttctgttttgtactcttatttctggatatgcttctacatataaaaattcccttttggtgcaaaggcttatgttacacatgttcctcttgtgcaggattggttaaaatcctcaagaagtacgacaagagaaccggctccatgatccgtctccccttcgtccagaaggtgctgcagcaacccttcttcaccaccgacctcctctacaagctcgtgaaggaatgcgaggagatgctggaccagctcatgccgacgaacgaacactcggtagcgagcgaagatgggaaagatgacagcgaaggggaggagaagggttcaaagcccagctcctcctcctcggccaacggtggagccgtcccgggagaggccgaggccgaggatgagaggagcacggacatgaagagcaccgtcacggcggcgctcagggcgctgagagagatccggagcgggagctcgacggtgagcgtcttctccctgccgcctctgcacggcagcaatgggcaggatgaaccggggaggtgaaaacgagaatgggaaagaaaaggaaatgatcttgacgctgcgttcggtatcgttgtttcgcctgcacttctgctcaaatgctcagtgatcttggcacttggtaggagtttgtaactggctatcagttcatgtttcgttttaacttgggtatttttcgtgtaatctgtttgtttcccacctgctgtaaaaatgagagggaaaaatagattagtataaagttcagggtaaacatagatctcaatgtgcagcctgactactttgtcacttgatgggatgatttttttttgtttatgtgcttctgtgtttgttagatggtttgtatggctgtatatatatatatatttttagtaaattgcagtttgggtc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052763.1 RefSeq:Os02g0202200]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 2]]
| |
| − | [[Category:Chromosome 2]]
| |