Difference between revisions of "Os06g0597500"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os06g0597500| Description = Protein prenyltransferase domain containing protein| Version = NM_001064524.1 GI:115468779 GeneID:4341435| Length = ...")
 
(Annotated Information)
 
(6 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os06g0597500''''' was reported as '''''sped1-D''''' in 2014 <ref name="ref1" /> by researchers from China.  
GeneName = Os06g0597500|
 
Description = Protein prenyltransferase domain containing protein|
 
Version = NM_001064524.1 GI:115468779 GeneID:4341435|
 
Length = 1593 bp|
 
Definition = Oryza sativa Japonica Group Os06g0597500, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
[[File:68-Os06g0597500.png|right|thumb|427px|'''Figure 1.''' ''The phenotype of the panicles of the sped1-D mutant..<ref name="ref1" />.'']]
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
===Gene Symbol===
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
*'''''Os06g0597500''''' '''<=>''' '''''sped1-D,SPED1'''''
|
+
===Function===
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
+
* '''''sped1-D''''' encodes a pentatricopeptide repeat protein.
AP = Chromosome 6:24425032..24426624|
+
* '''''sped1-D''''' may prompt the shortening of pedicels and secondary branches by blocking the action of GID1L2, RFL, and Wox3.
CDS = 24425032..24426624|
+
* Overexpression of '''''sped1-D''''' in Arabidopsis resulted in the shortening of pedicels and clusters of siliques, which indicates that the function of sped1-D is highly conserved in monocotyledonous and dicotyledonous plants.
GCID = <gbrowseImage1>
+
* '''''sped1-D''''' promotes the shortening of pedicels and secondary branches, perhaps through the CLV-WUS pathway, and influences pollen fertility through the action of Rf1L.
name=NC_008399:24425032..24426624
+
 
source=RiceChromosome06
+
===Phenotypic analysis===
preset=GeneLocation
+
* In this study, the researchers identified a rice mutant of the O. sativa ssp. indica cultivar 9311. All of its pedicels and some secondary branches were significantly shortened, which caused varying degrees of spikelet clustering (Figure 1A). All of the pedicels in the mutant were long, regardless of whether they were clustered (Figure 1B).
</gbrowseImage1>|
+
* The degree of spikelet clustering mainly depended on the extent to which the secondary branches were shortened. Namely, when the secondary branches were shortened in one to three segments from the top of the panicle, a two- to four-spikelet cluster was produced.
GSID = <gbrowseImage2>
+
* The pedicel lengths of the first to sixth spikelet of a primary branch of the mutant were much shorter than those of the wild-type rice varieties (Figure 1C). A decrease in pollen fertility was also found in the mutant compared with the wild type.
name=NC_008399:24425032..24426624
+
* Moreover, as the degree of clustering increased in a panicle, the degree of abortion increased, while the thousand- grain weight of the rice decreased (Figure 1, D and E). In light of this discovery, we name the mutant sped1 (SHORTENED PEDICELS AND/OR SECONDARY BRANCHES 1).
source=RiceChromosome06
+
 
preset=GeneLocation
+
===Expression===
</gbrowseImage2>|
+
* '''''SPED''''' 1 or '''''sped1-D''''' was constitutively expressed in young inflorescences and other tissues or organs.
CDNA = <cdnaseq>atggcaatggcggcggcgaggaggggccacgggatgccgctctgggagtgcaacgtgctgatcaggacgctggcgaggcgggggagcttcgcgcgcgtcatggcggtgtactacgacctccgcgcgcggggactcgtggcggacagcttcacctacccgttcgtgctcagggccgtcggggtcctcaagctgtcggtcgaggggcgcaaggcgcacgcggccgctgtcaagaccgggttccggtgggacgcctacaccgggagctcgctgatggagatgtacacgatgctggggcgcgtggacatcgcgcggaaggtgttcgacgaaatgccgagtagggcgctggtgctgtggaacatgatggtcaggtgctacatcaggtgcgggtggtactcggcggcagttgctttgtctgaacagatggagagaagcggtgtcacacctgacagggtgacgttggtgacggcggtgacggcgtgctctagagcaagggacctgagcttgggaaggaggattcatgtgtacatggataacgtcttcggtttcaatctgccagttgcaaatgctctgctggacatgtacacgaagaatgattgcttggaagaggcggtgaaattgttcgagcaaatgcctgcgaggaacataatttcttggaccatacttgtgtcgggatatggccttgctgggcagctggacaaggccagagtgctcttcaaccagtgcaaagagaaggatctaattctgtggactgcaatgatcaatgcgtgtgtgcaacacggatgcttcgaggaggcgctgacattgttccgagatatgcagatgcaacgggttgagccagacaggttcactgttgtcactctcctgacatgctgtgccaatcttggcgctcttgatcaaggtgaatggattcaccagtatgctgaacaaaggaaaatgaagatcgatgcagtcctaggcaccgcattgattgacatgtattctaaatgtgggcacattgagaagtctctagaggtcttctggcgaatgcaaggcagagatgccacagcttggactgccatcatctgtgggctggccacaaatggtcaggctggtagagctcttgaactgtttcaagatatgcagagaagtaaagttaagcccgacggtgttacgtttattggggtgctaagtgcatgctgccatggtggcttggttgatgaaggccggaagcagttccatgcaatgagggaggtttatcagatagaaccaagagttgaacactatagctgccttgtgaacctcctaggtcgtgctggtctactagatgaagctgagaggttgatcggtgacgttccaattaacaaggatgctatgccactgtttggtgcactcctcactgcttgcaaggctcatgggaatgttgagatgagtgaacggttaaccaaacgaatctgtgagcaagattcccaaattactgatgtgaatttgctcatgtctaatgtatatgcaacagcaagtagatgggaggatgtgataagggtacggggcaagatggcacaccctactgtcaagaagaatgcagggtgtagcttgattgaggtgaaggggtactga</cdnaseq>|
+
* '''''sped1-D''''' had some effects on the expression of other genes associated with flower development.
AA = <aaseq>MAMAAARRGHGMPLWECNVLIRTLARRGSFARVMAVYYDLRARG                    LVADSFTYPFVLRAVGVLKLSVEGRKAHAAAVKTGFRWDAYTGSSLMEMYTMLGRVDI                    ARKVFDEMPSRALVLWNMMVRCYIRCGWYSAAVALSEQMERSGVTPDRVTLVTAVTAC                    SRARDLSLGRRIHVYMDNVFGFNLPVANALLDMYTKNDCLEEAVKLFEQMPARNIISW                    TILVSGYGLAGQLDKARVLFNQCKEKDLILWTAMINACVQHGCFEEALTLFRDMQMQR                    VEPDRFTVVTLLTCCANLGALDQGEWIHQYAEQRKMKIDAVLGTALIDMYSKCGHIEK                    SLEVFWRMQGRDATAWTAIICGLATNGQAGRALELFQDMQRSKVKPDGVTFIGVLSAC                    CHGGLVDEGRKQFHAMREVYQIEPRVEHYSCLVNLLGRAGLLDEAERLIGDVPINKDA                    MPLFGALLTACKAHGNVEMSERLTKRICEQDSQITDVNLLMSNVYATASRWEDVIRVR                    GKMAHPTVKKNAGCSLIEVKGY</aaseq>|
+
 
DNA = <dnaseqindica>1..1593#atggcaatggcggcggcgaggaggggccacgggatgccgctctgggagtgcaacgtgctgatcaggacgctggcgaggcgggggagcttcgcgcgcgtcatggcggtgtactacgacctccgcgcgcggggactcgtggcggacagcttcacctacccgttcgtgctcagggccgtcggggtcctcaagctgtcggtcgaggggcgcaaggcgcacgcggccgctgtcaagaccgggttccggtgggacgcctacaccgggagctcgctgatggagatgtacacgatgctggggcgcgtggacatcgcgcggaaggtgttcgacgaaatgccgagtagggcgctggtgctgtggaacatgatggtcaggtgctacatcaggtgcgggtggtactcggcggcagttgctttgtctgaacagatggagagaagcggtgtcacacctgacagggtgacgttggtgacggcggtgacggcgtgctctagagcaagggacctgagcttgggaaggaggattcatgtgtacatggataacgtcttcggtttcaatctgccagttgcaaatgctctgctggacatgtacacgaagaatgattgcttggaagaggcggtgaaattgttcgagcaaatgcctgcgaggaacataatttcttggaccatacttgtgtcgggatatggccttgctgggcagctggacaaggccagagtgctcttcaaccagtgcaaagagaaggatctaattctgtggactgcaatgatcaatgcgtgtgtgcaacacggatgcttcgaggaggcgctgacattgttccgagatatgcagatgcaacgggttgagccagacaggttcactgttgtcactctcctgacatgctgtgccaatcttggcgctcttgatcaaggtgaatggattcaccagtatgctgaacaaaggaaaatgaagatcgatgcagtcctaggcaccgcattgattgacatgtattctaaatgtgggcacattgagaagtctctagaggtcttctggcgaatgcaaggcagagatgccacagcttggactgccatcatctgtgggctggccacaaatggtcaggctggtagagctcttgaactgtttcaagatatgcagagaagtaaagttaagcccgacggtgttacgtttattggggtgctaagtgcatgctgccatggtggcttggttgatgaaggccggaagcagttccatgcaatgagggaggtttatcagatagaaccaagagttgaacactatagctgccttgtgaacctcctaggtcgtgctggtctactagatgaagctgagaggttgatcggtgacgttccaattaacaaggatgctatgccactgtttggtgcactcctcactgcttgcaaggctcatgggaatgttgagatgagtgaacggttaaccaaacgaatctgtgagcaagattcccaaattactgatgtgaatttgctcatgtctaatgtatatgcaacagcaagtagatgggaggatgtgataagggtacggggcaagatggcacaccctactgtcaagaagaatgcagggtgtagcttgattgaggtgaaggggtactga</dnaseqindica>|
+
===Subcellular localization===
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001064524.1 RefSeq:Os06g0597500]|
+
* Subcellular localization indicates that the '''''SPED1-YFP''''' and '''''sped1-D-YFP''''' fusion proteins are mainly targeted to the cytoplasm
}}
+
 
[[Category:Genes]]
+
You can also add sub-section(s) at will.
[[Category:Japonica mRNA]]
+
 
[[Category:Oryza Sativa Japonica Group]]
+
==Labs working on this gene==
[[Category:Japonica Genes]]
+
* Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China
[[Category:Japonica Chromosome 6]]
+
 
[[Category:Chromosome 6]]
+
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Jiang G, Xiang Y, Zhao J, Yin D, Zhao X, Zhu L, Zhai W. Regulation of
 +
inflorescence branch development in rice through a novel pathway involving the
 +
pentatricopeptide repeat protein sped1-D. Genetics. 2014 Aug;197(4):1395-407.
 +
doi: 10.1534/genetics.114.163931. Epub 2014 Jun 20. PubMed PMID: 24950892; PubMed
 +
Central PMCID: PMC4125408.
 +
 
 +
</ref>
 +
 
 +
</references>
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 6]]

Latest revision as of 13:01, 14 October 2016

The rice Os06g0597500 was reported as sped1-D in 2014 [1] by researchers from China.

Annotated Information

Figure 1. The phenotype of the panicles of the sped1-D mutant..[1].

Gene Symbol

  • Os06g0597500 <=> sped1-D,SPED1

Function

  • sped1-D encodes a pentatricopeptide repeat protein.
  • sped1-D may prompt the shortening of pedicels and secondary branches by blocking the action of GID1L2, RFL, and Wox3.
  • Overexpression of sped1-D in Arabidopsis resulted in the shortening of pedicels and clusters of siliques, which indicates that the function of sped1-D is highly conserved in monocotyledonous and dicotyledonous plants.
  • sped1-D promotes the shortening of pedicels and secondary branches, perhaps through the CLV-WUS pathway, and influences pollen fertility through the action of Rf1L.

Phenotypic analysis

  • In this study, the researchers identified a rice mutant of the O. sativa ssp. indica cultivar 9311. All of its pedicels and some secondary branches were significantly shortened, which caused varying degrees of spikelet clustering (Figure 1A). All of the pedicels in the mutant were long, regardless of whether they were clustered (Figure 1B).
  • The degree of spikelet clustering mainly depended on the extent to which the secondary branches were shortened. Namely, when the secondary branches were shortened in one to three segments from the top of the panicle, a two- to four-spikelet cluster was produced.
  • The pedicel lengths of the first to sixth spikelet of a primary branch of the mutant were much shorter than those of the wild-type rice varieties (Figure 1C). A decrease in pollen fertility was also found in the mutant compared with the wild type.
  • Moreover, as the degree of clustering increased in a panicle, the degree of abortion increased, while the thousand- grain weight of the rice decreased (Figure 1, D and E). In light of this discovery, we name the mutant sped1 (SHORTENED PEDICELS AND/OR SECONDARY BRANCHES 1).

Expression

  • SPED 1 or sped1-D was constitutively expressed in young inflorescences and other tissues or organs.
  • sped1-D had some effects on the expression of other genes associated with flower development.

Subcellular localization

  • Subcellular localization indicates that the SPED1-YFP and sped1-D-YFP fusion proteins are mainly targeted to the cytoplasm

You can also add sub-section(s) at will.

Labs working on this gene

  • Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China

References

  1. 1.0 1.1 Jiang G, Xiang Y, Zhao J, Yin D, Zhao X, Zhu L, Zhai W. Regulation of inflorescence branch development in rice through a novel pathway involving the pentatricopeptide repeat protein sped1-D. Genetics. 2014 Aug;197(4):1395-407. doi: 10.1534/genetics.114.163931. Epub 2014 Jun 20. PubMed PMID: 24950892; PubMed Central PMCID: PMC4125408.

Structured Information