Difference between revisions of "Os04g0620000"

From RiceWiki
Jump to: navigation, search
(Gene Symbol)
 
(19 intermediate revisions by 5 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os04g0620000''''' was reported as '''''OsABCC1''''' in 2014 <ref name="ref1" /> by researchers from Korea and Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os04g0620000''''' '''<=>''' '''''OsABCC1,ABCC1,OsMRP1,MRP1'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* '''''OsABCC1''''' is a member of Oryza sativa C-type ATP-binding cassette (ABC) transporter (OsABCC) family, which is involved in the detoxification and reduction of As in rice grains.
 +
* Knockout of '''''OsABCC1''''' in rice resulted in decreased tolerance to As, but did not affect cadmium toxicity. At the reproductive growth stage, the As content was higher in the nodes and in other tissues of wild-type rice than in those of OsABCC1 knockout mutants, but was significantly lower in the grain.
 +
* '''''OsABCC1''''' limits As transport to the grains by sequestering As in the vacuoles of the phloem companion cells of the nodes in rice.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* OsABCC1 was expressed in many organs, including the roots, leaves, nodes, peduncle, and rachis. Expression was not affected when plants were exposed to low levels of As but was up-regulated in response to high levels of As.
  
===Evolution===
+
===Subcellular localization===
Please input evolution information here.
+
* In both the basal nodes and upper nodes, which are connected to the panicle, OsABCC1 was localized to the phloem region of vascular bundles.  
 +
* OsABCC1 was localized to the tonoplast and conferred phytochelatin-dependent As resistance in yeast.
 +
 
 +
==Labs working on this gene==
 +
* Division of Integrative Biosciences and Biotechnology, Pohang University of Science and Technology, Pohang 790-784, Korea
 +
* Institute of Plant Science and Resources, Okayama University, Chuo 2-20-1, Kurashiki 710-0046, Japan
 +
* Graduate School of Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
 +
* Institute of Plant Biology, University Zurich, 8008 Zurich, Switzerland<b><br>
  
You can also add sub-section(s) at will.
 
  
==Labs working on this gene==
+
[[File:Os04g0620000 1.png|center|thumb|800px|'''Figure 1.''' ''Expression pattern of OsABCC1.<ref name="ref1" />.'']]
Please input related labs here.
 
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Song, Won-Yong, et al. "A rice ABC transporter, OsABCC1, reduces arsenic accumulation in the grain." Proceedings of the National Academy of Sciences 111.44 (2014): 15699-15704.
 +
</ref>
 +
 
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 4]]
GeneName = Os04g0620000|
 
Description = Similar to Canalicular multispecific organic anion transporter 2 (Multidrug resistance-associated protein 3) (Multi-specific organic anion tranporter-D) (MOAT-D). Splice isoform 3S1|
 
Version = NM_001060439.2 GI:297603369 GeneID:4337027|
 
Length = 2079 bp|
 
Definition = Oryza sativa Japonica Group Os04g0620000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
 
AP = Chromosome 4:31901512..31903590|
 
CDS = 31901815..31901909,31902284..31902605,31902795..31902896,31903445..31903588|
 
GCID = <gbrowseImage1>
 
name=NC_008397:31901512..31903590
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008397:31901512..31903590
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>acagcagctgttgatgttcgaacagatgctcttatacagaagacaatcagggaagaattcaagagttgtacaatgcttataattgctcaccgcctgaacactgttattgactgtgacaggttgcttattctaagtgctgggaaggttttggagttcgactctcctgagaatcttttgagcaatgagcacagtgctttctccaagatggttcagagtacaggacctagcaatgcagagtacctgaagactcttgtatttggggatggtgaggagaggttgcgaaaggaagaaagcaagatgcaagatatccagaggaagtgggtagcatctaaccgatgggctgttgctgcgcagtttgcgcttgccgctagccttgcctcttcacacagtgaccttcttgcactggaggctgctgagggaaacaacatcctcaggaaaacaaaggatgcagtaatcactctacagaatgtcctcgaagggaagcacaacaccgaaattgatgatacactcgctcagtatgaggttccatctgataggtggtggtcatcgctatacaaagtcatggaaggacttgccatgatgagccgattgggtcgcaaccgtctacagcaaccaagttataattttgaaaacaacagttctattgactgggaccaaatgtag</cdnaseq>|
 
AA = <aaseq>TAAVDVRTDALIQKTIREEFKSCTMLIIAHRLNTVIDCDRLLIL                    SAGKVLEFDSPENLLSNEHSAFSKMVQSTGPSNAEYLKTLVFGDGEERLRKEESKMQD                    IQRKWVASNRWAVAAQFALAASLASSHSDLLALEAAEGNNILRKTKDAVITLQNVLEG                    KHNTEIDDTLAQYEVPSDRWWSSLYKVMEGLAMMSRLGRNRLQQPSYNFENNSSIDWD                    QM</aaseq>|
 
DNA = <dnaseqindica>1682..1776#986..1307#695..796#3..146#caacagcagctgttgatgttcgaacagatgctcttatacagaagacaatcagggaagaattcaagagttgtacaatgcttataattgctcaccgcctgaacactgttattgactgtgacaggttgcttattctaagtgctgggaaggtatgcttttgaagagatgtttcttcttttgttctggtgctttgcctctcatttgaatagtacaacaataaattcctgataatatcaacatgcttgataggtgtaatttccaaagtaaccaatgaaggattgttgcttgtctgttttggactcttgatttgaatgttgctttccttagctcctggagcttagtttccacaattttccaactgaactaaaacgtggtcatagtgagcttgtctgtaattagtatcatactatcctttacaatctctatattataaagtgttatttcaactgtcatgtttccagtgttctgttttcatattttattagtattatagatgacttgtaagagcattgaattcaccctgaaaagactcttggtatttattaacctagtgagatagatggcttgaaataattctgttcactctgacaaatagagagctaaacacgttcaggttgcactcttttcgtgctcagcctattatttttcttgattgcttaatttttggcacctcagttatgaaactactacttttcaggttttggagttcgactctcctgagaatcttttgagcaatgagcacagtgctttctccaagatggttcagagtacaggacctagcaatgcagagtacctgaaggtgtttttctatcatctcgatgttcttgaaatttgtgtactacagcataaaacagcgtttgataaataataatgagtgatgctgttcaatccatgttacactccatcgctcaagttttcacagttggctttcagcgaaattattgatatgtgttctgattcaacttttttttgactgaattattgacagactcttgtatttggggatggtgaggagaggttgcgaaaggaagaaagcaagatgcaagatatccagaggaagtgggtagcatctaaccgatgggctgttgctgcgcagtttgcgcttgccgctagccttgcctcttcacacagtgaccttcttgcactggaggctgctgagggaaacaacatcctcaggaaaacaaaggatgcagtaatcactctacagaatgtcctcgaagggaagcacaacaccgaaattgatgatacactcgctcagtatgaggttccatctgataggtggtggtcatcgctatacaaagtcatggaaggtacgttgatcacttcattttaacacctttctcttgtgcgatgcttcagagtagcatgtattgtgtgcaatataagtttattacactagtcccagtgtaaactggctaatattgatccgtcagagattctgatgaaaccaatagttaacagtgagtaccggattggtgcttggtcgatgcaaaagtccatatgttaacatgaagagaactgctgaaatataacgatagggataagattttcttggaccaacaaacatactaacacttgacaaaagcatgtcctccacatgccattgtcatgatctctttagtattcaaatctaaccctatcaatctgaccttttgatcaaatatgtatatctattttttttcaggacttgccatgatgagccgattgggtcgcaaccgtctacagcaaccaagttataattttgaaaacaacagttctattgactgggaccaaatgtagatgtgcaagcatgactgatccctgaagccctgttgcagagtagatttggagctgtaggcttttccagcaggtgttaattcctggagacatgtaaattgtcaccagcacattggcgtgcatgtcgtaagtagatttaccgtcctgactccctccctaaaggtgaataacaggggagtttttctgttcttttttgcaacagcatgaccatattcttgttgtactgccgtcctcaaggacatcgtctgttgtgcaaaatcttattagcattgtacctgaaaattgaaattttgatggtcttgtgcc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060439.2 RefSeq:Os04g0620000]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 4]]
 
[[Category:Chromosome 4]]
 

Latest revision as of 06:59, 15 October 2016

The rice Os04g0620000 was reported as OsABCC1 in 2014 [1] by researchers from Korea and Japan.

Annotated Information

Gene Symbol

  • Os04g0620000 <=> OsABCC1,ABCC1,OsMRP1,MRP1

Function

  • OsABCC1 is a member of Oryza sativa C-type ATP-binding cassette (ABC) transporter (OsABCC) family, which is involved in the detoxification and reduction of As in rice grains.
  • Knockout of OsABCC1 in rice resulted in decreased tolerance to As, but did not affect cadmium toxicity. At the reproductive growth stage, the As content was higher in the nodes and in other tissues of wild-type rice than in those of OsABCC1 knockout mutants, but was significantly lower in the grain.
  • OsABCC1 limits As transport to the grains by sequestering As in the vacuoles of the phloem companion cells of the nodes in rice.

Expression

  • OsABCC1 was expressed in many organs, including the roots, leaves, nodes, peduncle, and rachis. Expression was not affected when plants were exposed to low levels of As but was up-regulated in response to high levels of As.

Subcellular localization

  • In both the basal nodes and upper nodes, which are connected to the panicle, OsABCC1 was localized to the phloem region of vascular bundles.
  • OsABCC1 was localized to the tonoplast and conferred phytochelatin-dependent As resistance in yeast.

Labs working on this gene

  • Division of Integrative Biosciences and Biotechnology, Pohang University of Science and Technology, Pohang 790-784, Korea
  • Institute of Plant Science and Resources, Okayama University, Chuo 2-20-1, Kurashiki 710-0046, Japan
  • Graduate School of Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
  • Institute of Plant Biology, University Zurich, 8008 Zurich, Switzerland


Figure 1. Expression pattern of OsABCC1.[1].

References

  1. 1.0 1.1 Song, Won-Yong, et al. "A rice ABC transporter, OsABCC1, reduces arsenic accumulation in the grain." Proceedings of the National Academy of Sciences 111.44 (2014): 15699-15704.

Structured Information