|
|
| (12 intermediate revisions by 2 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''Os02g0256200''' was reported as '''OsHARP''' in 2009 <ref name="ref1" /> by researchers from the Japan. |
| − | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | [[File:34.png |right |thumb |345px |''''''Fig. 2 Co-immunoprecipitation assay showing in vivo interactions |
| | + | between OsCRT and OsCRT interacting protein, OsHARP. '''''']] |
| | + | ===Gene Symbol=== |
| | + | *'''Os02g0256200 <=> OsHARP''' |
| | + | <br> |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| + | *HARP in rice leaf sheath cell division or elongation and suggest that CRT may interact with HARP during certain stages of development. |
| | + | <br> |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | Please input expression information here.
| + | *The mRNA expression level of OsHARP was up-regulated in rice seedlings treated with gibberellin (GA), but not ABA and showed a similar pattern as OsCRT mRNA. |
| − | | + | *Rice plants transformed with the OsHARP promoter-GUS construct showed GUS staining in the basal parts of leaf sheaths, and although GUS activity increased when treated with GA3, it was not as high an increase as when mRNA was analyzed. |
| − | ===Evolution===
| + | <br> |
| − | Please input evolution information here.
| |
| − | | |
| − | You can also add sub-section(s) at will.
| |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | *National Institute of Crop Science, 2-1-18 Kannondai,Tsukuba 305-8518, Japan |
| | + | <br> |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | <references> |
| | + | <ref name="ref1"> |
| | + | Characterization of a histidine- and alanine-rich protein showing interaction with calreticulin in rice |
| | + | </ref> |
| | + | |
| | + | </references> |
| | + | <br> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]] |
| − | GeneName = Os02g0256200|
| |
| − | Description = Conserved hypothetical protein|
| |
| − | Version = NM_001053004.1 GI:115445378 GeneID:4328921|
| |
| − | Length = 1302 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os02g0256200, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
| |
| − | AP = Chromosome 2:8871946..8873247|
| |
| − | CDS = 8872186..8873214|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008395:8871946..8873247
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008395:8871946..8873247
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggcccgcctcgccgtcgccgccgcactcctcctcgtcgccctctgccgcgtcgtccacggcgaggccgatcaggagaccgcccccgcctacgccaaccgtgaagcctacgtcgagcacaatggtggtgacgccgccggcacgtccgtcgccatcgtcccgccctacctcgacgccgccgccgccgcccgtgacgagcccgcggcggcggcggcgagccccgaggggcctgtgatcccggtcgacgacgacgcggcggaccagcagggcttcctccgcttcccctgccgctaccactgccgctaccgccaccacatgcgccacggcggccatcgccatggggagggattccatggcaaggaggagaagcagcagctggtgttcgagatgccagtcgagccggcgacccgcggcgaggagcgcagggaggaggaggagggggtggttctccccgtcgcggagccagatccggactcgcgccgccagtatgccgccgtagccgccgccgaggaggaagacgaggatgagatggcgaggctccaccacggccgccgctcccaccaccaccatcatcgccaccaccatcatcaccacgacgagaacgaggaggacgagcacgagcaggccgacgaggcttcgcccgccgtggagcggttgatcagcttccaccgccgccgccaccaccaccaccaccacgaagacgaccacgagcagcgcgaggagggtgcgcccatgaagcggttccgccaccaccacgaggaggaggaggagtccgagatgaggaccaagcgcttccaccaccaccaccacaaggacgacgacgagcgcgagctggaggagatggcgaggcggtggatcaggaaggcgctgatgagcagcaggatgcaccaccaccgcggctgccgcttccaccaccaccaccaccacctcagcttccgccaccgcgcggaggacgccgccgccgccggcgaggaggaggagaaaggcggggtgatgagttggctcaaggactttgtgaaccgcttctag</cdnaseq>|
| |
| − | AA = <aaseq>MARLAVAAALLLVALCRVVHGEADQETAPAYANREAYVEHNGGD AAGTSVAIVPPYLDAAAAARDEPAAAAASPEGPVIPVDDDAADQQGFLRFPCRYHCRY RHHMRHGGHRHGEGFHGKEEKQQLVFEMPVEPATRGEERREEEEGVVLPVAEPDPDSR RQYAAVAAAEEEDEDEMARLHHGRRSHHHHHRHHHHHHDENEEDEHEQADEASPAVER LISFHRRRHHHHHHEDDHEQREEGAPMKRFRHHHEEEEESEMRTKRFHHHHHKDDDER ELEEMARRWIRKALMSSRMHHHRGCRFHHHHHHLSFRHRAEDAAAAGEEEEKGGVMSW LKDFVNRF</aaseq>|
| |
| − | DNA = <dnaseqindica>34..1062#gtcggtcaacgccgcgctcgatctctcgccgccatggcccgcctcgccgtcgccgccgcactcctcctcgtcgccctctgccgcgtcgtccacggcgaggccgatcaggagaccgcccccgcctacgccaaccgtgaagcctacgtcgagcacaatggtggtgacgccgccggcacgtccgtcgccatcgtcccgccctacctcgacgccgccgccgccgcccgtgacgagcccgcggcggcggcggcgagccccgaggggcctgtgatcccggtcgacgacgacgcggcggaccagcagggcttcctccgcttcccctgccgctaccactgccgctaccgccaccacatgcgccacggcggccatcgccatggggagggattccatggcaaggaggagaagcagcagctggtgttcgagatgccagtcgagccggcgacccgcggcgaggagcgcagggaggaggaggagggggtggttctccccgtcgcggagccagatccggactcgcgccgccagtatgccgccgtagccgccgccgaggaggaagacgaggatgagatggcgaggctccaccacggccgccgctcccaccaccaccatcatcgccaccaccatcatcaccacgacgagaacgaggaggacgagcacgagcaggccgacgaggcttcgcccgccgtggagcggttgatcagcttccaccgccgccgccaccaccaccaccaccacgaagacgaccacgagcagcgcgaggagggtgcgcccatgaagcggttccgccaccaccacgaggaggaggaggagtccgagatgaggaccaagcgcttccaccaccaccaccacaaggacgacgacgagcgcgagctggaggagatggcgaggcggtggatcaggaaggcgctgatgagcagcaggatgcaccaccaccgcggctgccgcttccaccaccaccaccaccacctcagcttccgccaccgcgcggaggacgccgccgccgccggcgaggaggaggagaaaggcggggtgatgagttggctcaaggactttgtgaaccgcttctaggtctctcgatcgatcagcctagcttgccgctgcttcttcttctccatcgtctgcttgtgttgttgtgtcgagttcattcatgattcatatggctgctgtgtattctacttttctacggccgtatatgtatttcgtataccgtatttgtgttgtggtactctcgacttatcccgagtgttcatgttgttgtttgtgtcacggatgttaataaattgttctcctatttcaaatgcgtgcatt</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001053004.1 RefSeq:Os02g0256200]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 2]]
| |
| − | [[Category:Chromosome 2]]
| |
