Difference between revisions of "Os03g0151300"

From RiceWiki
Jump to: navigation, search
(Expression)
 
(4 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os03g0151300''''' was reported as '''''Se14,''''' in 2014 <ref name="ref1" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
* '''''Se14''''' locus is involved in the photoperiodic pathway to flowering.
 +
* '''''Se14''''' is independent of the known photoperiod-sensitive genes, such as Hd1 and Ghd7, and it encodes a Jumonji C (JmjC) domain-containing protein.
 +
* '''''Se14''''' is a novel photoperiod-sensitivity gene that has a suppressive effect on floral transition (flowering time) under long day-length conditions through the modification of chromatin structure by H3K4me3 demethylation in the promoter region of RFT1.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* HS112 is an early flowering time mutant, which was induced by gamma-ray irradiation of seeds of the japonica rice variety Gimbozu (WT; Figure 1A). The early flowering of this mutant line has proved to be conferred by a single recessive mutant allele se14 at the Se14 locus [24].
 
+
* The researchers examined the days to heading (DH; = flowering time) of HS112 and the WT under the following five day-length conditions: 10 h (SD), 14.5 h (14.5 LD), 16 h (16 LD), 24 h (24 LD), and a natural day-length (ND) in their experimental field in Kyoto, Japan (NL35u019).
===Evolution===
+
* In addition, the researchers examined the DH of two single mutant lines, hd1 and ghd7, which harbor recessive mutant alleles at the Hd1 and Ghd7 loci, respectively, under 16 LD and 24 LD conditions. Under SD, HS112 (54.9 DH) showed almost the same DH as that of WT (59.8 DH). Under 14.5 LD, however, HS112 exhibited 75.7 DH, while WT (91.8 DH) flowered two weeks later than HS112 (Figure 1B).
Please input evolution information here.
+
* Under ND, both HS112 and WT exhibited similar DH to plants under 14.5 LD, respectively. In Kyoto, the natural day-length is longer than the critical day-length (approximately 13.5 h) and does not exceed 14.5 h during the cropping season from May to the end of July [25]. This is regarded as a long day-length condition.
 +
* After July, it becomes shorter than 13.5 h, which is regarded as a short day-length condition [10]. Thus, the ND and 14.5 LD used in this study were considered to be almost the same photoperiod. Under 16 LD and 24 LD conditions, neither the WT nor HS112 flowered even after 150 days from sowing (Figure 1C).  
 +
* In contrast, the hd1 and ghd7 mutants flowered 115 and 130 days after sowing, respectively.<br><br>
 +
[[File:Os03g0151300.png|center|thumb|727px|'''Figure 1.''' ''Phenotype of early flowering mutant HS112.<ref name="ref1" />.'']]
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Graduate School of Agriculture, Kyoto University, Kyoto, Japan
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Yokoo T, Saito H, Yoshitake Y, Xu Q, Asami T, Tsukiyama T, Teraishi M, Okumoto
 +
Y, Tanisaka T. Se14, encoding a JmjC domain-containing protein, plays key roles
 +
in long-day suppression of rice flowering through the demethylation of H3K4me3 of
 +
RFT1. PLoS One. 2014 Apr 23;9(4):e96064. doi: 10.1371/journal.pone.0096064.
 +
eCollection 2014. PubMed PMID: 24759811; PubMed Central PMCID: PMC3997562.
 +
</ref>
 +
</references>
 +
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 3]]
GeneName = Os03g0151300|
 
Description = Similar to Early flowering 6|
 
Version = NM_001186341.1 GI:297721812 GeneID:9268736|
 
Length = 4136 bp|
 
Definition = Oryza sativa Japonica Group Os03g0151300, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:2811469..2815604|
 
CDS = 2812825..2812891,2813606..2813756,2815467..2815604|
 
GCID = <gbrowseImage1>
 
name=NC_008396:2811469..2815604
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:2811469..2815604
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>ttggtgcaatatcctggtgagtttgtggtgacattcccaagggcttaccatgtcgggtttagccatggattcaattgtggagaagctgccaattttgcgactccccaatggttgaagtttgctaaagaggctgcagttcgaagggctgtgatgaattatcttccaatgctctcccatcaacaactattgtacttgctagcagtttcatttatatccaggaaccctagagaactactgtctggaatccgaacttctcgtctaagagatcgtaaaaaagaagaccgagaactgttggtcaaacaggaattcttgcaggatatgattagtgaaaatgaacttatatgttcatttcttgg</cdnaseq>|
 
AA = <aaseq>LVQYPGEFVVTFPRAYHVGFSHGFNCGEAANFATPQWLKFAKEA                    AVRRAVMNYLPMLSHQQLLYLLAVSFISRNPRELLSGIRTSRLRDRKKEDRELLVKQE                    FLQDMISENELICSFLG</aaseq>|
 
DNA = <dnaseqindica>1357..1423#2138..2288#3999..4136#gcacaccgtcttcgcaatctcctttggtcggctgcccaatcctcccttcccttcctctcctcaaacccccccaacccaaatgctcccctccgctccccgtccccgcctcccaaaaccctagccctctcgccgcgcgctccccccctgatgccgccccagcctccgccggcggcgtcggcgtcggccagtgccccggatcccgccgtcccggcttggctcagggggctcccccgcgcgcccgagtaccgcccgacggagtccgagttcgccgaccccatcgccttcctctcccgcgtggagcgcgaggccgccgcctacggcatctgcaaggtcatcccgccccacccgcgcccttcccgccgcttcgtcttcgcccacctcaaccgctccctcgtctcctcctgcgacgcccccgcgccctctcccgccgccgcctccgactcgtccattcctccatcctcctcctcgccgccgccggtctccgccgcggtgttcacgacacggcaccaggagctcggcaacccgcggcgtggacgcccgacgccgcaggtgcttaagcaggtgtggcagagtggggagcggtacacgctcgaccagtttgagtccaagtcccgcgccttctcaaagacgcacctcgctggactccacgaaccgactgcgctcgcggtggaatcactcttctggaaggcgtcggcggaccgtcctatctatattgagtacgccaatgatgtccctggctctgggtttgctgcacccgtgcagttgcaacgcaagaagaagcagaaaagagagactgccccgatggacgaatgggagaagagttcaggctggaggctgtcaaatagcccatggaacctgcaagcaattgcgcgggctcctggttcgctcacacggtttatgcctgacgatgttcctggggtgacttctccaatggtttacattggcatgctgttcagctggtttgcgtggcatgtggaggatcatgatctgcatagtctcaacttcctccacactggcgcacctaagacgtggtatgcggttcctggtgatagggctgttgagcttgaggaagttatccgtgtacatggctatggaggcaacactgatcggatcggtatttgtcttatattgtgtttctttatccagatcttgtgctcacgcgatggtgcgaatgatatgagttctggttggtttctgcagcgtcactagcagtgcttggtgagaaaacaacactaatgtccccagaggtccttatagacaatggtgtgccctgctgtaggtacaagttctgaaaccgtcagcaatcaatacaccaatcttaattaatttatgtgttgacatgcattgtatttcagattggtgcaatatcctggtgagtttgtggtgacattcccaagggcttaccatgtcgggtttagccatggtgggttaaatcatacatattttgaactcacaatacttgttatttgattcatcagtatgtgctagttgttaaatcatctgaaccttgtatgctttaatttaatttctttatggtattgtcaatgaacacaaatcttttacaatacacagtgcatgtggctgcatagatctaggcatgaagtgcagttgtcgatgtgatggagccgtggtagtaatacacactcagttataatataaccaatatttgctactgttttgtcttgtcatgaatcataattcaagataataaactaggttattcagatgatactaatgggtaatggcaaaacaaattactctttcatacttgtttcctgaagcaagattatggtgatccttttaccgttgtcttaactagtttggtgagtttgatttttttcaacttcatactaattttttgaagaattcaagcttcttcgtattaacctatttgcgttcatagttttatggaacacttgagatcctcttaaggatctcactttatatctgagagtcaacctatctatgagattcatttactttgtggaaccaaaagaaacaatttgtagattgtggtatgttgtagaaactgaatatccaatgcagtcagcagcatgtcatgttcagtagattccttattttattttgttgctatgcatgctatcggcaactctaatgttcgtgtaatataatacaggattcaattgtggagaagctgccaattttgcgactccccaatggttgaagtttgctaaagaggctgcagttcgaagggctgtgatgaattatcttccaatgctctcccatcaacaactattgtacttgctagcagtttcatttatatccaggtttttttttctttttctttttggagtttggttttgtgctgtccaaagtgtctttttagtttttgcacctcattaataggttgatgaaacaaaatatattacctttgtcctccaacaaaccaaatgctacagctagtgggtaggggttagatgcttgttaggtctgccatacagaaggattacgcataaccgcaaaggtgaagttgtcatggtgctcctgggagacgccgcattacaggatcaccacaatgctaggtgtaagctagacttcaactaaatcacattatattccaagtatatcagatggaaatataaacggcaaatggaaaatgtagcgcataaaacccactcaagccgctacacccacccgctacccagtccatgagcccatttctccaccctctccctcatcccctcccctaagctgtactctctctcctctcctctcttaagtcaccttggattctagattgcccaactctatatgggaagctaaggcttctagagtccctagggaataggaaatttgcattcatagtttccatatgtattttttgtgcacaacagttttgatgataagttgtatatgtttttttaccttcatacatatattttgcataagttgtttatgttttacataaattggtatttgctagcttgccgctttacattttgaatctggcaatggtttacgttatttgtagcatagtgctctctggattatagtagatgggacaccatgattgaaggttactctctgggatagttatccaatgtagtaagaactcataaagggttttagatgtatcatatatgtgaacaagtgtttgcgaaggttcaggctctagctgggaaacagatcagtgcttagcacctaatttaccctaaggtggacctaggagggtctagggtggctgcctaggagggaagatggctttgatatatatattaaaactgaccattctagatgttaccagaataagttacaactgactatggctgtgttcggcaccccttcttcccaacccatctcccttgttttccgtgcgcacgcttttcaaactgctaaacggtgcgttttttgcaaaaagtttctatatgaaagttgctttaaaaaaaatcaaattaatccatttttgaaaaaaaagctaatacttaattaatcacgcgctaatggatcgctccgttttccgtgagcactgttcttttgggaacagtgccgaacacagcctatatcttcggacatggaaatctgaaatgataaacaattgaaacaacagaagaagccaaaaggtccaaaatatatgctttatcgaaacaaaagaaatggaagtaagtgctgatgattacatccctatggattctgccactgtaacaattccatgtttgttggaagccatcaatattcactccccaaagagaagctaacaagcagaatgttggctgtctgcatccacacaaattacttgccttttttatccattgttcattttgttttgaaagcttctattgttcatttgttgctcacatgattgccttgtgttttggaatttcattgattattcgaagtgtttaatattgaagcactcatttgattgtatattttaatcattacctctaatgctttctgtgcccatttatattaacaagtatgctaaatcattatcatagcacacacttatgagtctgctggattcattttattttcaggaaccctagagaactactgtctggaatccgaacttctcgtctaagagatcgtaaaaaagaagaccgagaactgttggtcaaacaggaattcttgcaggatatgattagtgaaaatgaacttatatgttcatttcttgg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001186341.1 RefSeq:Os03g0151300]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 3]]
 
[[Category:Chromosome 3]]
 

Latest revision as of 08:32, 15 October 2016

The rice Os03g0151300 was reported as Se14, in 2014 [1] by researchers from Japan.

Annotated Information

Function

  • Se14 locus is involved in the photoperiodic pathway to flowering.
  • Se14 is independent of the known photoperiod-sensitive genes, such as Hd1 and Ghd7, and it encodes a Jumonji C (JmjC) domain-containing protein.
  • Se14 is a novel photoperiod-sensitivity gene that has a suppressive effect on floral transition (flowering time) under long day-length conditions through the modification of chromatin structure by H3K4me3 demethylation in the promoter region of RFT1.

Expression

  • HS112 is an early flowering time mutant, which was induced by gamma-ray irradiation of seeds of the japonica rice variety Gimbozu (WT; Figure 1A). The early flowering of this mutant line has proved to be conferred by a single recessive mutant allele se14 at the Se14 locus [24].
  • The researchers examined the days to heading (DH; = flowering time) of HS112 and the WT under the following five day-length conditions: 10 h (SD), 14.5 h (14.5 LD), 16 h (16 LD), 24 h (24 LD), and a natural day-length (ND) in their experimental field in Kyoto, Japan (NL35u019).
  • In addition, the researchers examined the DH of two single mutant lines, hd1 and ghd7, which harbor recessive mutant alleles at the Hd1 and Ghd7 loci, respectively, under 16 LD and 24 LD conditions. Under SD, HS112 (54.9 DH) showed almost the same DH as that of WT (59.8 DH). Under 14.5 LD, however, HS112 exhibited 75.7 DH, while WT (91.8 DH) flowered two weeks later than HS112 (Figure 1B).
  • Under ND, both HS112 and WT exhibited similar DH to plants under 14.5 LD, respectively. In Kyoto, the natural day-length is longer than the critical day-length (approximately 13.5 h) and does not exceed 14.5 h during the cropping season from May to the end of July [25]. This is regarded as a long day-length condition.
  • After July, it becomes shorter than 13.5 h, which is regarded as a short day-length condition [10]. Thus, the ND and 14.5 LD used in this study were considered to be almost the same photoperiod. Under 16 LD and 24 LD conditions, neither the WT nor HS112 flowered even after 150 days from sowing (Figure 1C).
  • In contrast, the hd1 and ghd7 mutants flowered 115 and 130 days after sowing, respectively.

Figure 1. Phenotype of early flowering mutant HS112.[1].

You can also add sub-section(s) at will.

Labs working on this gene

  • Graduate School of Agriculture, Kyoto University, Kyoto, Japan

References

  1. 1.0 1.1 Yokoo T, Saito H, Yoshitake Y, Xu Q, Asami T, Tsukiyama T, Teraishi M, Okumoto Y, Tanisaka T. Se14, encoding a JmjC domain-containing protein, plays key roles in long-day suppression of rice flowering through the demethylation of H3K4me3 of RFT1. PLoS One. 2014 Apr 23;9(4):e96064. doi: 10.1371/journal.pone.0096064. eCollection 2014. PubMed PMID: 24759811; PubMed Central PMCID: PMC3997562.


Structured Information