|
|
| (6 intermediate revisions by 2 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''Os03g0133400''' was reported as ''' CEBiP''' in 2010 <ref name="ref1" /> by researchers from the Japan. |
| − | | + | <br> |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | [[File:44.png |left |thumb |234px |''''''Figure 1. Effects of knockdown of CEBiP on the infection behavior of M. oryzae in rice leaf sheaths.'''''']] |
| | + | ===Gene Symbol=== |
| | + | *'''Os03g0133400 <=> CEBiP''' |
| | + | <br> |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| + | *The plasma membrane glycoprotein CEBiP, which possesses LysM domains, is a receptor for the chitin elicitor (CE) in rice. |
| | + | *Perception of CE by CEBiP contributes to disease resistance against the rice blast fungus, Magnaporthe oryzae, and that enhanced responses to CE by engineering CEBiP increase disease tolerance. |
| | + | <br> |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | Please input expression information here.
| + | *The expression of either CRXa1 or CRXa3, each of which contains the whole extracellular portion of CEBiP, the whole intracellular domain of XA21, and the transmembrane domain from either CEBiP or XA21, induced cell death accompanied by an increased production of reactive oxygen and nitrogen species after treatment with CE. |
| | + | <br> |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| − | Please input evolution information here.
| + | *Knockdown of CEBiP expression allowed increased spread of the infection hyphae. To enhance defense responses to CE, the researchers constructed chimeric genes composed of CEBiP and Xa21, which mediate resistance to rice bacterial leaf blight. |
| − | | + | <br> |
| − | You can also add sub-section(s) at will.
| |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | *Division of Plant Sciences, National Institute of Agrobiological Sciences, Kannondai 2-1-2, Tsukuba, Ibaraki,305-8602 Japan, |
| − | | + | *Department of Life Sciences, Faculty of Agriculture, Meiji University, Higashi-mita 1-1-1, Tama-ku, Kawasaki,Kanagawa, 214-8571 Japan |
| | + | <br> |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | <references> |
| | + | <ref name="ref1"> |
| | + | Perception of the chitin oligosaccharides contributes to disease resistance to blast fungus Magnaporthe oryzae in rice |
| | + | </ref> |
| | | | |
| | + | </references> |
| | + | <br> |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 3]] |
| − | GeneName = Os03g0133400|
| |
| − | Description = Peptidoglycan-binding LysM domain containing protein|
| |
| − | Version = NM_001055410.1 GI:115450548 GeneID:4331523|
| |
| − | Length = 2799 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os03g0133400, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
| |
| − | AP = Chromosome 3:1857247..1860045|
| |
| − | CDS = 1857333..1857999,1859105..1859225,1859318..1859505,1859597..1859691|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008396:1857247..1860045
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008396:1857247..1860045
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggcgtcgctcaccgccgccctggccacgccggcggccgctgccctcctcctcctcgtcctcctcgccgcccccgcctccgccgccaacttcacctgcgcggtggcttcaggcaccacctgcaagtccgccatcctctacacctcccccaacgccaccacctacggcaacctcgtcgcccgcttcaacaccaccaccctccccgacctcctcggcgccaacggcctccccgacggcacgctttcctccgcccccgtcgccgccaattccaccgtcaaaatccccttccgctgccgctgcaacggcgacgtcggccagtcggaccgcctccccatctacgtcgtgcagccgcaggacgggctcgacgccatcgcgcgcaacgtgttcaacgccttcgtcacctaccaggagatcgccgccgcgaacaacatccccgaccccaacaagataaatgtcagccagacgctgtggattccgctgccctgcagctgcgacaaggaggaaggctctaacgtgatgcacctcgcctacagcgtcggcaaaggggagaacacgtcggcgatcgctgccaagtacggggtgacggagtccacgcttctcaccagaaataagatcgacgaccccacgaaattgcagatgggacagattctagatgtcccgctccctgtgtgccgttcatcaatcagcgatacctcagctgatcacaatctgatgctcctcccggatggcacctatggattcaccgcaggaaactgcatccgctgcagctgcagttcaactacctaccagctaaactgcactgcagtacagaacaagggatgcccgtcagtgccactgtgcaatggaacgctgaagcttggtgagacgaacggcaccggttgcggatcaacaacgtgcgcctacagtggttactccaacagttcatcgctcatcatacaaaccagccttgcaactaatcagacaacagcctgccagagaggaggatctgggaggtcgcagttcgctaggtccatgtggagcatgtctgttatctccttccacatggtgttgatcattatctgtttcctttga</cdnaseq>|
| |
| − | AA = <aaseq>MASLTAALATPAAAALLLLVLLAAPASAANFTCAVASGTTCKSA ILYTSPNATTYGNLVARFNTTTLPDLLGANGLPDGTLSSAPVAANSTVKIPFRCRCNG DVGQSDRLPIYVVQPQDGLDAIARNVFNAFVTYQEIAAANNIPDPNKINVSQTLWIPL PCSCDKEEGSNVMHLAYSVGKGENTSAIAAKYGVTESTLLTRNKIDDPTKLQMGQILD VPLPVCRSSISDTSADHNLMLLPDGTYGFTAGNCIRCSCSSTTYQLNCTAVQNKGCPS VPLCNGTLKLGETNGTGCGSTTCAYSGYSNSSSLIIQTSLATNQTTACQRGGSGRSQF ARSMWSMSVISFHMVLIIICFL</aaseq>|
| |
| − | DNA = <dnaseqindica>87..753#1859..1979#2072..2259#2351..2445#atactcctcctgctccagtgtcaacacgacagtcaaacaaacaccaagcctctcattcccacctctcgaggagagctttccccaccatggcgtcgctcaccgccgccctggccacgccggcggccgctgccctcctcctcctcgtcctcctcgccgcccccgcctccgccgccaacttcacctgcgcggtggcttcaggcaccacctgcaagtccgccatcctctacacctcccccaacgccaccacctacggcaacctcgtcgcccgcttcaacaccaccaccctccccgacctcctcggcgccaacggcctccccgacggcacgctttcctccgcccccgtcgccgccaattccaccgtcaaaatccccttccgctgccgctgcaacggcgacgtcggccagtcggaccgcctccccatctacgtcgtgcagccgcaggacgggctcgacgccatcgcgcgcaacgtgttcaacgccttcgtcacctaccaggagatcgccgccgcgaacaacatccccgaccccaacaagataaatgtcagccagacgctgtggattccgctgccctgcagctgcgacaaggaggaaggctctaacgtgatgcacctcgcctacagcgtcggcaaaggggagaacacgtcggcgatcgctgccaagtacggggtgacggagtccacgcttctcaccagaaataagatcgacgaccccacgaaattgcagatgggacagattctagatgtcccgctccctggtacgtgccttgctgttactgtttagtatggttcttgcaatcttgtgatcgagctcagaagttttttgtttaacagtgaattttctcagtagactagtcttactagtactataagagaagaaacttgaattagttaggcaggtgtttagttcacttcaaactttctaaaattccatcacatcaaatgtttggatatatgcatggagcattaaatatggacaaaaaaaaaaccaattgcacagtttgcatgtaaattgcgagacgaatcttttgagtctaattacgccatgatttgacaatctgatgctataataaacatttgctaatgacggattaattaggtttaataaattcgtctcgcagtttatatacggaatctatactttgttttgttattagtctacgtttaatacttcaaatgtgtgtccgtatacttcaagaaaattttagcacacgaactaaacacggccttactcgtattactacctctacatggttgactggggagactgaagattagctgtgttgttctgttagtttgcatattaaacttaggttaggtatggtaaattatttgcaatatgctgataatatattgctcggattcagtggtatttgcaatgaacttaggctatggtccccttgcatgatggagtttatcagaatcaaaatatctggttgtgactcggaaagttgctctcaagaaaagatagctagctgcacatgcttcgatcgttgagagattgagacaacatgacacatagctccactagcacatgagtagaaagccacaaaattccatcgcaatgttgaggaatttaagctttagagcttgaattcctgcactctttggacttgtataattagttagccgttgctatcaccggacaaactatctgactttgtggtttaaaattacggaataaactaccaataccaatccacaaagttgaccctcgctactcacaaggtttcaaaatatactattatagtactatcttagatggatcttgatgtttactactattcactttcttcggtaagaatgtcatatgaaacgagttcctagacctagtactaacttctggaaaactggtgtcctcagtgtgccgttcatcaatcagcgatacctcagctgatcacaatctgatgctcctcccggatggcacctatggattcaccgcaggaaactgcatccgctgcagctgcagttcaactacctaccagtatgctcccctattatttccatctccttctaagttgtttctgatcaagcagtaaccaaagaatttacatttcttttcactgtgtcaaccaggctaaactgcactgcagtacagaacaagggatgcccgtcagtgccactgtgcaatggaacgctgaagcttggtgagacgaacggcaccggttgcggatcaacaacgtgcgcctacagtggttactccaacagttcatcgctcatcatacaaaccagccttgcaactaatcagacaacagcctgccagagtaagttgagcccgcaaacctgtacaaactcagagtctctgagtttgtttgagttaaagaaacggcaggtttctaatagttgattttgcaggaggaggatctgggaggtcgcagttcgctaggtccatgtggagcatgtctgttatctccttccacatggtgttgatcattatctgtttcctttgatgttggagactactgcaactctagatggtacatttcaaagagttctctacgatctatgattgttgtatacgatatatgattgttgtcgtaacttagattttgatgactggtttatccagctttgaaatttgagttttgactctgttctttagaggatgagtggcacttgtacggctgcttgaataaaacgtcgatgtattgtattcgatctgcatctgaaaaggaatattcattagataggattattcgaaataaaaagatcccacatgtttttgttataggcgttacatgttctggatggatatataatgtaccatgcggaagtatgaatggacttcccaccttccaatcttc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055410.1 RefSeq:Os03g0133400]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 3]]
| |
| − | [[Category:Chromosome 3]]
| |
