Difference between revisions of "Os04g0684900"

From RiceWiki
Jump to: navigation, search
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os04g0684900''''' was reported as '''''OsCAF1B''''' in 2014 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:88-Os08g0440300.png|right|thumb|427px|'''Figure 6.''' ''Subcellular localization of OsCAF1–GFP fusion proteins in onion epidermal cells..<ref name="ref1" />.'']]
 +
===Gene Symbol===
 +
*'''''Os04g0684900''''' '''''<=>''''' '''''OsCAF1B''''','''''CAF1B'''''
 
===Function===
 
===Function===
Please input function information here.
+
* '''''CAF1''''' belongs to the RNase D group in the DEDD superfamily, and is a protein conserved through evolution from yeast to humans and plants.
 +
* Researchers identified and cloned four OsCAF1 genes ('''''OsCAF1A''''', '''''OsCAF1B''''', '''''OsCAF1G''''', and '''''OsCAF1H''''') from rice. Point mutations in the catalytic residues of each analyzed recombinant '''''OsCAF1''''' proteins were shown to disrupt deadenylase activity.
 +
* '''''OsCAF1''''' proteins may be involved in the deadenylation in rice.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* The unique expression patterns of each '''''OsCAF1''''' were observed in various tissues when undergoing abiotic stress treatments, implying that each CAF1 gene in rice plays a specific role in the development and stress response of a plant.
  
===Evolution===
+
===Subcellular localizations===
Please input evolution information here.
+
* To determine the subcellular localizations of '''''OsCAF1''''' proteins, '''''OsCAF1''''' genes were fused with GFP under the control of a 35S promoter and introduced into onion epidermal cells using particle bombardment.
 +
* As shown in Fig. 6b, fluorescence signals from GFP fused to the C terminal of each '''''OsCAF1''''' protein ('''''OsCAF1'''''–GFP) were present not only in the nucleus but also in the cytoplasm, the same cellular localization pattern as GFP only.
 +
* In the cytoplasm, '''''OsCAF1A'''''–, '''''OsCAF1G'''''– and '''''OsCAF1H'''''–GFP protein signals were distributed uniformly (Fig. 6b), whereas '''''OsCAF1B''''' (L)–GFP was localized to specific cytosolic foci and formed filamentous structures (Figs. 6b, c).
 +
* Similar subcellular localization patterns were observed when GFP fused to the N-terminus of each '''''OsCAF1''''' (GFP–OsCAF1). We further examined the subcellular localization of '''''OsCAF1''''' proteins by fusing another reporter, β-glucuronidase (GUS), in onion epidermal cells.
 +
* Each OsCAF1 fusion proteins ('''''OsCAF1'''''–GUS) were distributed both in the nucleus and cytoplasm, whereas GUS was predominantly localized in the cytoplasm. The OsCAF1B–GUS was also localized to specific cytosolic foci and filamentous structures.
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Department of Life Sciences, National Central University, Jhongli City, Taoyuan County 320, Taiwan, ROC
 
+
* Graduate School of Biotechnology and Bioengineering, Yuan Ze University, Jhongli City, Taoyuan County 320, Taiwan, ROC
 +
* Department of Agricultural Chemistry, National Taiwan University, Taipei 10617, Taiwan, ROC
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Chou WL, Huang LF, Fang JC, Yeh CH, Hong CY, Wu SJ, Lu CA. Divergence of the
 +
expression and subcellular localization of CCR4-associated factor 1 (CAF1)
 +
deadenylase proteins in Oryza sativa. Plant Mol Biol. 2014 Jul;85(4-5):443-58.
 +
doi: 10.1007/s11103-014-0196-7. Epub 2014 May 8. PubMed PMID: 24805883.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 4]]
GeneName = Os04g0684900|
 
Description = Ribonuclease CAF1 family protein|
 
Version = NM_001060848.1 GI:115461425 GeneID:4337457|
 
Length = 1219 bp|
 
Definition = Oryza sativa Japonica Group Os04g0684900, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
 
AP = Chromosome 4:35380465..35381683|
 
CDS = 35380576..35380607,35380728..35381565|
 
GCID = <gbrowseImage1>
 
name=NC_008397:35380465..35381683
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008397:35380465..35381683
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgccgtcagagttcgtcgccgccaggaagaagccgccggtggagatacgccgggtgtgggcgcacaacgtggaggaggaattccggatcatccgcaacgcgatcgatcacttcccgtacgtgtccatggacacggagtttcccggcgtgatccaccgcccgaccaagcaccccgccctgctcaccgccggcgaccggtacgacctcctccgccgcaacgtggacgcgctccacctcatccaggtgggcatcaccctcgccgcgtcccccaccgcggcgcccgcgctcgccttcgagatcaacctctccgacttcgaccagcgcgtccaccgccacgccgccgagtccgtccagctgctggcggagcacggcgtggacctcgccgcgcaccgcaggcacggcgtcagggcgagcgcgctggcgccgctgctcatgtcgtcgggcctcgtctgctcccacggcgccgtcaagtgggtcaccttccactccgcctacgacttcgcctacctggtcaagctcctcatggggcggaagctgccgaggtccatggccgagttcctgaacctggtgcgcgtcttcttcggcgacgaggtgtacgacgtgaagcacatgatgcggcactgcggcggcgagctgtacggcgggctggagcgcgtggcggcggcgctgcaggtgaagcgcgcggcggggcggtgccaccaggccgcctccgacagcttgctcacctgggacgtcttccggcggatgcgggagctctacttcctcaagcatggcgtcgaggcctaccaaggcgtgctcttcggcctggagctcgacatggacatgcccagcaacaaaacaccctcgctgccgctggtggcagcgagatga</cdnaseq>|
 
AA = <aaseq>MPSEFVAARKKPPVEIRRVWAHNVEEEFRIIRNAIDHFPYVSMD                    TEFPGVIHRPTKHPALLTAGDRYDLLRRNVDALHLIQVGITLAASPTAAPALAFEINL                    SDFDQRVHRHAAESVQLLAEHGVDLAAHRRHGVRASALAPLLMSSGLVCSHGAVKWVT                    FHSAYDFAYLVKLLMGRKLPRSMAEFLNLVRVFFGDEVYDVKHMMRHCGGELYGGLER                    VAAALQVKRAAGRCHQAASDSLLTWDVFRRMRELYFLKHGVEAYQGVLFGLELDMDMP                    SNKTPSLPLVAAR</aaseq>|
 
DNA = <dnaseqindica>112..143#264..1101#aaacaggcaaacgcactcgcatctccaattcggtccgaatttttccaaattccaattgctcatcgcgcttcgaattcgttgccgagatccatccaatctttgagttaagacatgccgtcagagttcgtcgccgccaggaagaagccgccgccggagttgttgttcgccgccggtcggaagaagcagcagccgccgccgcctggcatggcgttcgtgccgtcggagttcgccgccgccggcgttggcaggaagaggcagcctgcgccgccggtggagatacgccgggtgtgggcgcacaacgtggaggaggaattccggatcatccgcaacgcgatcgatcacttcccgtacgtgtccatggacacggagtttcccggcgtgatccaccgcccgaccaagcaccccgccctgctcaccgccggcgaccggtacgacctcctccgccgcaacgtggacgcgctccacctcatccaggtgggcatcaccctcgccgcgtcccccaccgcggcgcccgcgctcgccttcgagatcaacctctccgacttcgaccagcgcgtccaccgccacgccgccgagtccgtccagctgctggcggagcacggcgtggacctcgccgcgcaccgcaggcacggcgtcagggcgagcgcgctggcgccgctgctcatgtcgtcgggcctcgtctgctcccacggcgccgtcaagtgggtcaccttccactccgcctacgacttcgcctacctggtcaagctcctcatggggcggaagctgccgaggtccatggccgagttcctgaacctggtgcgcgtcttcttcggcgacgaggtgtacgacgtgaagcacatgatgcggcactgcggcggcgagctgtacggcgggctggagcgcgtggcggcggcgctgcaggtgaagcgcgcggcggggcggtgccaccaggccgcctccgacagcttgctcacctgggacgtcttccggcggatgcgggagctctacttcctcaagcatggcgtcgaggcctaccaaggcgtgctcttcggcctggagctcgacatggacatgcccagcaacaaaacaccctcgctgccgctggtggcagcgagatgatacgatctcctctcctccgctgtaaaatttgttgattcgtcgtctgcaagaaaggatttctttcggcagatgtacagtaataataagagggaaaaaaagatggtttaattgattggtt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060848.1 RefSeq:Os04g0684900]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 4]]
 
[[Category:Chromosome 4]]
 

Latest revision as of 04:10, 16 October 2016

The rice Os04g0684900 was reported as OsCAF1B in 2014 [1] by researchers from China.

Annotated Information

Figure 6. Subcellular localization of OsCAF1–GFP fusion proteins in onion epidermal cells..[1].

Gene Symbol

  • Os04g0684900 <=> OsCAF1B,CAF1B

Function

  • CAF1 belongs to the RNase D group in the DEDD superfamily, and is a protein conserved through evolution from yeast to humans and plants.
  • Researchers identified and cloned four OsCAF1 genes (OsCAF1A, OsCAF1B, OsCAF1G, and OsCAF1H) from rice. Point mutations in the catalytic residues of each analyzed recombinant OsCAF1 proteins were shown to disrupt deadenylase activity.
  • OsCAF1 proteins may be involved in the deadenylation in rice.

Expression

  • The unique expression patterns of each OsCAF1 were observed in various tissues when undergoing abiotic stress treatments, implying that each CAF1 gene in rice plays a specific role in the development and stress response of a plant.

Subcellular localizations

  • To determine the subcellular localizations of OsCAF1 proteins, OsCAF1 genes were fused with GFP under the control of a 35S promoter and introduced into onion epidermal cells using particle bombardment.
  • As shown in Fig. 6b, fluorescence signals from GFP fused to the C terminal of each OsCAF1 protein (OsCAF1–GFP) were present not only in the nucleus but also in the cytoplasm, the same cellular localization pattern as GFP only.
  • In the cytoplasm, OsCAF1A–, OsCAF1G– and OsCAF1H–GFP protein signals were distributed uniformly (Fig. 6b), whereas OsCAF1B (L)–GFP was localized to specific cytosolic foci and formed filamentous structures (Figs. 6b, c).
  • Similar subcellular localization patterns were observed when GFP fused to the N-terminus of each OsCAF1 (GFP–OsCAF1). We further examined the subcellular localization of OsCAF1 proteins by fusing another reporter, β-glucuronidase (GUS), in onion epidermal cells.
  • Each OsCAF1 fusion proteins (OsCAF1–GUS) were distributed both in the nucleus and cytoplasm, whereas GUS was predominantly localized in the cytoplasm. The OsCAF1B–GUS was also localized to specific cytosolic foci and filamentous structures.

You can also add sub-section(s) at will.

Labs working on this gene

  • Department of Life Sciences, National Central University, Jhongli City, Taoyuan County 320, Taiwan, ROC
  • Graduate School of Biotechnology and Bioengineering, Yuan Ze University, Jhongli City, Taoyuan County 320, Taiwan, ROC
  • Department of Agricultural Chemistry, National Taiwan University, Taipei 10617, Taiwan, ROC

References

  1. 1.0 1.1 Chou WL, Huang LF, Fang JC, Yeh CH, Hong CY, Wu SJ, Lu CA. Divergence of the expression and subcellular localization of CCR4-associated factor 1 (CAF1) deadenylase proteins in Oryza sativa. Plant Mol Biol. 2014 Jul;85(4-5):443-58. doi: 10.1007/s11103-014-0196-7. Epub 2014 May 8. PubMed PMID: 24805883.

Structured Information