Difference between revisions of "Os10g0513200"

From RiceWiki
Jump to: navigation, search
(Gene Symbol)
 
(5 intermediate revisions by 4 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os10g0513200''''' was reported as '''''OsNIP3;1''''' in 2014 <ref name="ref1" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os10g0513200''''' '''''<=>''''' '''''OsNIP3;1,NIP3-1'''''
 +
[[File:97-Os10g0513200.png|right|thumb|327px|'''Figure 2.''' ''Subcellular localization of GFP–OsNIP3;1.<ref name="ref1" />.'']]
 +
 
===Function===
 
===Function===
Please input function information here.
+
* '''''OsNIP3;1''''' is a member of the major intrinsic protein family in rice
 
+
* '''''OsNIP3;1''''' regulates boron distribution among shoot tissues, and that the correct boron distribution is crucial for plant growth.
 +
* '''''OsNIP3;1''''' promoter activity in the exodermis and vascular bundles
 
===Expression===
 
===Expression===
Please input expression information here.
+
* The accumulation of '''''OsNIP3;1''''' transcript increased fivefold in roots within 6 h of the onset of boron starvation, but not in shoots. Promoter–GUS analysis suggested that OsNIP3;1 is expressed mainly in exodermal cells and steles in roots, as well as in cells around the vascular bundles in leaf sheaths and pericycle cells around the xylem in leaf blades.
  
===Evolution===
+
===Subcellular Localization===
Please input evolution information here.
+
* Subcellular localization analysis showed that '''''OsNIP3;1''''' was localized to the plasma membrane
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Biotechnology Research Center, University of Tokyo, Tokyo 113–8657, Japan
 +
* Graduate School of Agricultural and Life Sciences, University of Tokyo, Tokyo 113–8657, Japan
 +
* Division of Applied Bioscience, Graduate School of Agriculture, Hokkaido University, Sapporo 060–8589, Japan
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Hanaoka H, Uraguchi S, Takano J, Tanaka M, Fujiwara T. OsNIP3;1, a rice boric
 +
acid channel, regulates boron distribution and is essential for growth under
 +
boron-deficient conditions. Plant J. 2014 Jun;78(5):890-902. doi:
 +
10.1111/tpj.12511. Epub 2014 May 8. PubMed PMID: 24654769.
 +
</ref>
 +
</references>
 +
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os10g0513200|
 
Description = Similar to Nodulin-26 (N-26)|
 
Version = NM_001071583.2 GI:297610777 GeneID:4349102|
 
Length = 1570 bp|
 
Definition = Oryza sativa Japonica Group Os10g0513200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|
 
AP = Chromosome 10:20233381..20234950|
 
CDS = 20233841..20234036,20234687..20234949|
 
GCID = <gbrowseImage1>
 
name=NC_008403:20233381..20234950
 
source=RiceChromosome10
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008403:20233381..20234950
 
source=RiceChromosome10
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>gtcccggcgtacgtcgccgtccaggtgctcggctccatctgcgccggcttcgccctcaagggcgtcttccaccccttcctctccggcggcgtcaccgtccccgaccccaccatctccaccgcccaggccttcttcaccgagttcatcatcaccttcaacctcctcttcgtcgtcaccgccgtcgccaccgacacccgcgccgtcggcgagctcgccggcatcgccgtcggcgccgccgtcaccctcaacatcctcatcgccgggccgacgacaggagggtcgatgaacccggtgaggacgctggggccggcggtggcggcgggcaactaccggcagctgtggatatacctgatcgcgccgacgctgggcgcggtcgccggcgccggcgtgtacacggcggtgaagctccgcgacgagaacggcgagaccccgcgcccccagcgcagcttccgccgctga</cdnaseq>|
 
AA = <aaseq>VPAYVAVQVLGSICAGFALKGVFHPFLSGGVTVPDPTISTAQAF                    FTEFIITFNLLFVVTAVATDTRAVGELAGIAVGAAVTLNILIAGPTTGGSMNPVRTLG                    PAVAAGNYRQLWIYLIAPTLGAVAGAGVYTAVKLRDENGETPRPQRSFRR</aaseq>|
 
DNA = <dnaseqindica>915..1110#2..264#ggtcccggcgtacgtcgccgtccaggtgctcggctccatctgcgccggcttcgccctcaagggcgtcttccaccccttcctctccggcggcgtcaccgtccccgaccccaccatctccaccgcccaggccttcttcaccgagttcatcatcaccttcaacctcctcttcgtcgtcaccgccgtcgccaccgacacccgcgccgtcggcgagctcgccggcatcgccgtcggcgccgccgtcaccctcaacatcctcatcgccgggtacgtataatcctcttcctcctccttgtagccaggttttaatctttcagtttgaatgtttctatcggaacgtgtcgatataccgaaatttggatcaaattttagtcaaattaagcaaattattaccaaaataaaaaaaattggccgaaataatcacataggggatccaaaataaccaaaattttggaaatttcatttcagaatttttgaaccctgctcgtagcacgttactgcctctgtgttatattgcaagtttattaaatttatataagaatatagtaacatttctaacataaataaacatattaaaagttagttttattaaaaactattttctataaatttggaaaaggaaattttgaaaaaaaaataaaacgacctataatatgaaacaatgagcactaaaaatggatggatttccaaaaaaaaaagaaaatttgaaccatgccacacaaattttataaattttgtaaaatttgtgatatgacaccctgacccacatgacattaacttatgtggttcctacgtgtcattgagatacgggtggcatattttaaattttacaaaattagggtgtcatggttccaacaaacaaaaaaaaaatggatggatttgatctccggctaaccggcggcgtgggtgcggtgcaggccgacgacaggagggtcgatgaacccggtgaggacgctggggccggcggtggcggcgggcaactaccggcagctgtggatatacctgatcgcgccgacgctgggcgcggtcgccggcgccggcgtgtacacggcggtgaagctccgcgacgagaacggcgagaccccgcgcccccagcgcagcttccgccgctgatccaaatcatatccaaatccatatccataaaaacaaattattatacacgacgtagttaacctgaacaaattatatggcttccaattaaaaaaaaatcagtcgtgtcatccttgggccttgttccacatgggccgaacaccaagagaaatccgcgtgaatatgggccgtgattttggttgaaaattttcggtccattcacgtagatgggccgggtttgaggccttttcaaatgagaccttgggggcgtgtaataaaccccgttttgcttcgtccagaacggcagagtataatagttcgagttgtgtgtgatgtgtcagaactcagaataaaaatgcacgccgatgcaccggggtgatgggcatcttgctgtgcgaatggtgtaaggttttatttaatttcctatttgacaaattgtgtaattttccctgttccgacattgataattgagaaaaattgtccc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001071583.2 RefSeq:Os10g0513200]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 04:48, 17 October 2016

The rice Os10g0513200 was reported as OsNIP3;1 in 2014 [1] by researchers from Japan.

Annotated Information

Gene Symbol

  • Os10g0513200 <=> OsNIP3;1,NIP3-1
Figure 2. Subcellular localization of GFP–OsNIP3;1.[1].

Function

  • OsNIP3;1 is a member of the major intrinsic protein family in rice
  • OsNIP3;1 regulates boron distribution among shoot tissues, and that the correct boron distribution is crucial for plant growth.
  • OsNIP3;1 promoter activity in the exodermis and vascular bundles

Expression

  • The accumulation of OsNIP3;1 transcript increased fivefold in roots within 6 h of the onset of boron starvation, but not in shoots. Promoter–GUS analysis suggested that OsNIP3;1 is expressed mainly in exodermal cells and steles in roots, as well as in cells around the vascular bundles in leaf sheaths and pericycle cells around the xylem in leaf blades.

Subcellular Localization

  • Subcellular localization analysis showed that OsNIP3;1 was localized to the plasma membrane

You can also add sub-section(s) at will.

Labs working on this gene

  • Biotechnology Research Center, University of Tokyo, Tokyo 113–8657, Japan
  • Graduate School of Agricultural and Life Sciences, University of Tokyo, Tokyo 113–8657, Japan
  • Division of Applied Bioscience, Graduate School of Agriculture, Hokkaido University, Sapporo 060–8589, Japan

References

  1. 1.0 1.1 Hanaoka H, Uraguchi S, Takano J, Tanaka M, Fujiwara T. OsNIP3;1, a rice boric acid channel, regulates boron distribution and is essential for growth under boron-deficient conditions. Plant J. 2014 Jun;78(5):890-902. doi: 10.1111/tpj.12511. Epub 2014 May 8. PubMed PMID: 24654769.


Structured Information