Difference between revisions of "Os02g0833000"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os02g0833000| Description = Similar to Serine/threonine-protein kinase PBS1 (EC 2.7.1.37) (AvrPphB susceptible protein 1)| Version = NM_001055167...")
 
(Gene Symbol)
 
(5 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os02g0833000''''' was reported as '''''GnTI''''' in 2013 <ref name="ref1" /> by researchers from Korea.  
GeneName = Os02g0833000|
 
Description = Similar to Serine/threonine-protein kinase PBS1 (EC 2.7.1.37) (AvrPphB susceptible protein 1)|
 
Version = NM_001055167.1 GI:115450061 GeneID:4331264|
 
Length = 1286 bp|
 
Definition = Oryza sativa Japonica Group Os02g0833000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Gene Symbol===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
*'''''Os02g0833000''''' '''''<=>''''' '''''OsGnTI,GnTI'''''
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
[[File:114-Os02g0833000 .png|right|thumb|327px|'''Figure 2.''' ''Developmental analysis of gnt1.<ref name="ref1" />.'']]
|
+
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
+
===Function===
AP = Chromosome 2:36708547..36709832|
+
* Oryza sativa '''''GnTI''''' encodes enzymatically and functionally active protein
CDS = 36708553..36709659|
+
*  Loss of '''''GnTI''''' function resulted in decreased cell wall synthesis activity, which might be responsible for the brittle phenotype and reduced tensile strength in gnt1.
GCID = <gbrowseImage1>
+
* '''''GnTI''''' plays an important role in cellulose biosynthesis in the plant.
name=NC_008395:36708547..36709832
+
===Phenotypic analysis===
source=RiceChromosome02
+
 
preset=GeneLocation
+
* Phenotypic analyses revealed that gnt1 shows defective post-seedling development and incomplete cell wall bio-synthesis, leading to symptoms such as failure in tiller formation, brittle leaves, reduced cell wall thickness, and decreased cellulose content.
</gbrowseImage1>|
+
* The developmental defects of gnt1 ultimately resulted in early lethality without transition to the reproductive stage.  
GSID = <gbrowseImage2>
+
* However, callus induced from gnt1 seeds could be maintained for periods, although it exhibited a low proliferation rate, small size, and hypersensitivity to salt stress.  
name=NC_008395:36708547..36709832
+
* Shoot regeneration and dark-induced leaf senescence assays indicated that the loss of GnTI function results in reduced sensitivity to cytokinin in rice.
source=RiceChromosome02
+
* Reduced expression of A-type O. sativa response regulators that are rapidly induced by cytokinins in gnt1 confirmed that cytokinin signaling is impaired in the mutant.
preset=GeneLocation
+
 
</gbrowseImage2>|
+
You can also add sub-section(s) at will.
CDNA = <cdnaseq>atgaaggaagggatgagctgcttctcgtggaaccccagcctgcggtgctggcatggcagcaatgacggcggcagcccgtgcagccaggccgcgcaggcggcgtcggcgggggcgggcggtgcgaagaagttcacgctggcgcagctgtcggcggccacggacgggttccacgagtccaacgttgtcggcgagggcgggttcggcagggtgtacagggggcgtctcgaggaaggcggccaagggctcgtggccgtgaagcagctctgccacggtggcgcgcagggaacccgcgagttcctggtggaatgcatgatgctcatgatgctgcaccaccccaacctcgtctccctcgtcggctactgcgccgacgccggcgagcgcctcctcgtctacgagttcctgccacgcggcagcctcgacgcgcacctcttcggcaggaggccgcaggagcccccgctggcgctggggtgggcggcgcgcgtcaggatcgcggtcggcgcggccagggggcttcgctacctgcacgaggtggtgacgccgccggtgatctaccgcgacctcaaggcgtccaacatcctgctcgacgacgacctcaaccccaggctgtcggactttggcctcgccaagctgggccccgtcggcgacgacacccacgtgtccacgcgcgtcatgggcacctacggctactgcgcgcccgactacgccatgagcggcaagctcaacgtcaagtccgacgtctacagcttcggcgtcgtgctcctcgagctcatcactggacgcagggccttcgacgccgcctcctccgactcggagtcggaggaccaccagcgcttcctcctcctccgggactgggcgcgcccctacctcgccggcgaccgcaagaggtgcttcgccctggccgacccggcgttgcagggccgctacccccgccgcgccttctaccagctcgccgtcgtcgcctcgctctgcctccgcgacaaccccaacctccgcccctccatgacagacgtcacccgagccctcgaccacgtcgcctcccagtcccagccatgggaagacaagcaaagagccaccaccaccacgcctcctcccaactcccaaccttaa</cdnaseq>|
+
 
AA = <aaseq>MKEGMSCFSWNPSLRCWHGSNDGGSPCSQAAQAASAGAGGAKKF                    TLAQLSAATDGFHESNVVGEGGFGRVYRGRLEEGGQGLVAVKQLCHGGAQGTREFLVE                    CMMLMMLHHPNLVSLVGYCADAGERLLVYEFLPRGSLDAHLFGRRPQEPPLALGWAAR                    VRIAVGAARGLRYLHEVVTPPVIYRDLKASNILLDDDLNPRLSDFGLAKLGPVGDDTH                    VSTRVMGTYGYCAPDYAMSGKLNVKSDVYSFGVVLLELITGRRAFDAASSDSESEDHQ                    RFLLLRDWARPYLAGDRKRCFALADPALQGRYPRRAFYQLAVVASLCLRDNPNLRPSM                    TDVTRALDHVASQSQPWEDKQRATTTTPPPNSQP</aaseq>|
+
==Labs working on this gene==
DNA = <dnaseqindica>7..1113#agatgaatgaaggaagggatgagctgcttctcgtggaaccccagcctgcggtgctggcatggcagcaatgacggcggcagcccgtgcagccaggccgcgcaggcggcgtcggcgggggcgggcggtgcgaagaagttcacgctggcgcagctgtcggcggccacggacgggttccacgagtccaacgttgtcggcgagggcgggttcggcagggtgtacagggggcgtctcgaggaaggcggccaagggctcgtggccgtgaagcagctctgccacggtggcgcgcagggaacccgcgagttcctggtggaatgcatgatgctcatgatgctgcaccaccccaacctcgtctccctcgtcggctactgcgccgacgccggcgagcgcctcctcgtctacgagttcctgccacgcggcagcctcgacgcgcacctcttcggcaggaggccgcaggagcccccgctggcgctggggtgggcggcgcgcgtcaggatcgcggtcggcgcggccagggggcttcgctacctgcacgaggtggtgacgccgccggtgatctaccgcgacctcaaggcgtccaacatcctgctcgacgacgacctcaaccccaggctgtcggactttggcctcgccaagctgggccccgtcggcgacgacacccacgtgtccacgcgcgtcatgggcacctacggctactgcgcgcccgactacgccatgagcggcaagctcaacgtcaagtccgacgtctacagcttcggcgtcgtgctcctcgagctcatcactggacgcagggccttcgacgccgcctcctccgactcggagtcggaggaccaccagcgcttcctcctcctccgggactgggcgcgcccctacctcgccggcgaccgcaagaggtgcttcgccctggccgacccggcgttgcagggccgctacccccgccgcgccttctaccagctcgccgtcgtcgcctcgctctgcctccgcgacaaccccaacctccgcccctccatgacagacgtcacccgagccctcgaccacgtcgcctcccagtcccagccatgggaagacaagcaaagagccaccaccaccacgcctcctcccaactcccaaccttaattcctccatctgctcattctagctactagttgcctagctctctctctctctctctctcttggttggattcccatgttatgttcccccttaatttggaaggccatgggtgatttcactgattgattttcatcattttcttagttgctcttcatgtatatatattaacctttaac</dnaseqindica>|
+
* Division of Applied Life Science (BK21 Program) and PMBBRC, Gyeongsang National University, 501 Jinju-daero, Jinju 660-701, Korea
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055167.1 RefSeq:Os02g0833000]|
+
* Division of Electron Microscopic Research, Korea Basic Science Institute, 113 Gwahangno, Yuseong-gu, Daejeon 305-333, Korea
}}
+
* Integrative Omics Research Center, Korea Research Institute of Bioscience and Biotechnology, Yuseong-gu, Daejeon 305- 806, Korea
[[Category:Genes]]
+
 
[[Category:Japonica mRNA]]
+
==References==
[[Category:Oryza Sativa Japonica Group]]
+
<references>
[[Category:Japonica Genes]]
+
* <ref name="ref1">
[[Category:Japonica Chromosome 2]]
+
Fanata WI, Lee KH, Son BH, Yoo JY, Harmoko R, Ko KS, Ramasamy NK, Kim KH, Oh
[[Category:Chromosome 2]]
+
DB, Jung HS, Kim JY, Lee SY, Lee KO. N-glycan maturation is crucial for
 +
cytokinin-mediated development and cellulose synthesis in Oryza sativa. Plant J.  
 +
2013 Mar;73(6):966-79. doi: 10.1111/tpj.12087. Epub 2013 Feb 25. PubMed PMID:
 +
23199012.
 +
</ref>
 +
</references>
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]

Latest revision as of 09:36, 18 October 2016

The rice Os02g0833000 was reported as GnTI in 2013 [1] by researchers from Korea.

Annotated Information

Gene Symbol

  • Os02g0833000 <=> OsGnTI,GnTI
Figure 2. Developmental analysis of gnt1.[1].

Function

  • Oryza sativa GnTI encodes enzymatically and functionally active protein
  • Loss of GnTI function resulted in decreased cell wall synthesis activity, which might be responsible for the brittle phenotype and reduced tensile strength in gnt1.
  • GnTI plays an important role in cellulose biosynthesis in the plant.

Phenotypic analysis

  • Phenotypic analyses revealed that gnt1 shows defective post-seedling development and incomplete cell wall bio-synthesis, leading to symptoms such as failure in tiller formation, brittle leaves, reduced cell wall thickness, and decreased cellulose content.
  • The developmental defects of gnt1 ultimately resulted in early lethality without transition to the reproductive stage.
  • However, callus induced from gnt1 seeds could be maintained for periods, although it exhibited a low proliferation rate, small size, and hypersensitivity to salt stress.
  • Shoot regeneration and dark-induced leaf senescence assays indicated that the loss of GnTI function results in reduced sensitivity to cytokinin in rice.
  • Reduced expression of A-type O. sativa response regulators that are rapidly induced by cytokinins in gnt1 confirmed that cytokinin signaling is impaired in the mutant.

You can also add sub-section(s) at will.

Labs working on this gene

  • Division of Applied Life Science (BK21 Program) and PMBBRC, Gyeongsang National University, 501 Jinju-daero, Jinju 660-701, Korea
  • Division of Electron Microscopic Research, Korea Basic Science Institute, 113 Gwahangno, Yuseong-gu, Daejeon 305-333, Korea
  • Integrative Omics Research Center, Korea Research Institute of Bioscience and Biotechnology, Yuseong-gu, Daejeon 305- 806, Korea

References

  1. 1.0 1.1 Fanata WI, Lee KH, Son BH, Yoo JY, Harmoko R, Ko KS, Ramasamy NK, Kim KH, Oh DB, Jung HS, Kim JY, Lee SY, Lee KO. N-glycan maturation is crucial for cytokinin-mediated development and cellulose synthesis in Oryza sativa. Plant J. 2013 Mar;73(6):966-79. doi: 10.1111/tpj.12087. Epub 2013 Feb 25. PubMed PMID: 23199012.

Structured Information