Difference between revisions of "Os03g0438100"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os03g0438100| Description = Similar to Allene oxide cyclase precursor (EC 5.3.99.6) (Allene oxide cylase)| Version = NM_001056982.2 GI:297601156 ...")
 
(Labs working on this gene)
 
(5 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os03g0438100''''' was reported as '''''OsAOC''''' in 2013 <ref name="ref1" /> by researchers from Germany and Japan.  
GeneName = Os03g0438100|
 
Description = Similar to Allene oxide cyclase precursor (EC 5.3.99.6) (Allene oxide cylase)|
 
Version = NM_001056982.2 GI:297601156 GeneID:4333201|
 
Length = 1302 bp|
 
Definition = Oryza sativa Japonica Group Os03g0438100, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
[[File:126-Os03g0438100.png|right|thumb|327px|'''Figure 1.''' ''Long-coleoptile phenotype of cpm2 and hebiba mutants.<ref name="ref1" />.'']]
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
===Gene Symbol===
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
*'''''Os03g0438100''''' '''''<=>''''' '''''OsAOC,AOC'''''
|
+
===Function===
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
+
* '''''OsAOC''''' encodes a functional AOC
AP = Chromosome 3:19121644..19122945|
+
* '''''OsAOC''''' is a functional enzyme that is involved in the biosynthesis of jasmonic acid and related compounds.
CDS = 19122001..19122402,19122500..19122820|
+
 
GCID = <gbrowseImage1>
+
===Phenotypic analysis===
name=NC_008396:19121644..19122945
+
* The mutant exhibited a long mesocotyl in etiolated seedlings. Furthermore, the mutant produced at most only a few fertile seeds in each panicle and is almost sterile. As the mutant was successfully pollinated by the wild-type, this feature is apparently caused by a reduction in male fertility.
source=RiceChromosome03
+
* The wild-type had a mean final coleoptile length of 6.6 mm, but cpm2 and heb- iba developed significantly longer coleoptiles (16.0 and 23.4 mm for cpm2 and hebiba, respectively). Thus, both mutants exhibit the long-coleoptile phenotype, but with different amplitude.
preset=GeneLocation
+
 
</gbrowseImage1>|
+
You can also add sub-section(s) at will.
GSID = <gbrowseImage2>
+
 
name=NC_008396:19121644..19122945
+
==Labs working on this gene==
source=RiceChromosome03
+
* Botanical Institute, Molecular Cell Biology, Karlsruhe Institute of Technology, Kaiserstraße 2, 76131 Karlsruhe, Germany,
preset=GeneLocation
+
* Division of Plant Sciences, National Institute of Agrobiological Sciences, 2–1–2 Kannondai, Tsukuba, Ibaraki 305–8602,Japan,
</gbrowseImage2>|
+
* Botanical Gardens, Graduate School of Science, Osaka City University, Kisaichi, Katano-shi, Osaka 576–0004, Japan,
CDNA = <cdnaseq>atggccgccgccgccccctcgcgagtctccgtcagggccgcggcgcccgggcaaacggggggcttcgccaagatccggccgcaggtggtggtggcagcggcggcgaggtcggccggggtgagcggccgcagggcgaggagcgttcgggcgtcgctgttctcgccgaagccggcgacgcccaaggacgcgaggccggccaaggtgcaggagatgttcgtgtacgagatcaacgagcgcgaccgcgagagccccgcctacctccgcctcagcgccaagcagacggagaacgccctcggcgatctcgtccccttcaccaacaagctgtacagcggaagcctggacaagcggctggggatctcggcggggatctgcatcctgatccagcacgtgccggagcgcaacggcgaccgctacgaggccatctacagcttctacttcggcgactacggccacatctccgtgcagggcccgtacctgacctacgaggagtcctacctcgccgtcaccggcggctccggcgtcttcgaaggcgcctacggccaggtcaagctcaaccagatcgtcttccccttcaagatcttctacaccttctacctcaagggcatccccgacctgccgcgggagctgctctgcacgcccgtcccgccgtccccgaccgtcgagccaacgccagccgccaaggccaccgagccccacgcctgcctcaacaacttcaccaactag</cdnaseq>|
+
* Biotechnology Research Center, University of Tokyo, 1–1–1 Yayoi, Bunkyo–ku, Tokyo 113–8657, Japan,
AA = <aaseq>MAAAAPSRVSVRAAAPGQTGGFAKIRPQVVVAAAARSAGVSGRR                    ARSVRASLFSPKPATPKDARPAKVQEMFVYEINERDRESPAYLRLSAKQTENALGDLV                    PFTNKLYSGSLDKRLGISAGICILIQHVPERNGDRYEAIYSFYFGDYGHISVQGPYLT                    YEESYLAVTGGSGVFEGAYGQVKLNQIVFPFKIFYTFYLKGIPDLPRELLCTPVPPSP                    TVEPTPAAKATEPHACLNNFTN</aaseq>|
+
* Rice Applied Genomics Research Unit, National Institute of Agrobiological Sciences, 2–1–2 Kannondai, Tsukuba, Ibaraki305–8602, Japan,
DNA = <dnaseqindica>544..945#126..446#ccgcaccgcaccaccaccgttgcggcatcaccaatcggcaatcgcagagcaaaagcatcgggaggagcaagctactagtagtagtatagtagtactagtcaaagaaatcaacagcttgattgaccatggccgccgccgccccctcgcgagtctccgtcagggccgcggcgcccgggcaaacggggggcttcgccaagatccggccgcaggtggtggtggcagcggcggcgaggtcggccggggtgagcggccgcagggcgaggagcgttcgggcgtcgctgttctcgccgaagccggcgacgcccaaggacgcgaggccggccaaggtgcaggagatgttcgtgtacgagatcaacgagcgcgaccgcgagagccccgcctacctccgcctcagcgccaagcagacggagaacgccctcggcgatctcgtccccttcaccaacaaggttcgctacctagtagtcccctagcttcttcttcatcctccgctcggtcgcggctgtgctgagagccgttcccctgcttggcctctggttcttgcagctgtacagcggaagcctggacaagcggctggggatctcggcggggatctgcatcctgatccagcacgtgccggagcgcaacggcgaccgctacgaggccatctacagcttctacttcggcgactacggccacatctccgtgcagggcccgtacctgacctacgaggagtcctacctcgccgtcaccggcggctccggcgtcttcgaaggcgcctacggccaggtcaagctcaaccagatcgtcttccccttcaagatcttctacaccttctacctcaagggcatccccgacctgccgcgggagctgctctgcacgcccgtcccgccgtccccgaccgtcgagccaacgccagccgccaaggccaccgagccccacgcctgcctcaacaacttcaccaactagctcaacccgcgctgtacatcacttccaagttccaattgctactgttactactctgccaataattgatggagatgcagatcgagctgcctgattagtttagtgttaattgcggcatgtgcggtgtgtatcgtatcactgataaggaagaggaatcgaggacaagatatttgtttcctccctgcgatgagccgatgaactgatccgaacaagaagaggcttcttggtagtaggtggattggaatatcgaaatgatatgattgtgatccgcaactacaacgaccgccactacggagagctcatgctatttgtttgtttgtttttgtactagtgctcaaatatatactccagctcatgtcc</dnaseqindica>|
+
* Agrigenomics Research Center, National Institute of Agrobiological Sciences, 1–2 Ohwashi, Tsukuba, Ibaraki 305–8634,Japan, and
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056982.2 RefSeq:Os03g0438100]|
+
* Department of Biosciences, Teikyo University, 1–1 Toyosatodai, Utsunomiya 320–8551, Japan
}}
+
 
[[Category:Genes]]
+
==References==
[[Category:Japonica mRNA]]
+
<references>
[[Category:Oryza Sativa Japonica Group]]
+
* <ref name="ref1">
[[Category:Japonica Genes]]
+
Riemann M, Haga K, Shimizu T, Okada K, Ando S, Mochizuki S, Nishizawa Y,
[[Category:Japonica Chromosome 3]]
+
Yamanouchi U, Nick P, Yano M, Minami E, Takano M, Yamane H, Iino M.
[[Category:Chromosome 3]]
+
Identification of rice Allene Oxide Cyclase mutants and the function of jasmonate
 +
for defence against Magnaporthe oryzae. Plant J. 2013 Apr;74(2):226-38. doi:
 +
10.1111/tpj.12115. Epub 2013 Mar 4. PubMed PMID: 23347338.
 +
</ref>
 +
</references>
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 3]]

Latest revision as of 13:38, 19 October 2016

The rice Os03g0438100 was reported as OsAOC in 2013 [1] by researchers from Germany and Japan.

Annotated Information

Figure 1. Long-coleoptile phenotype of cpm2 and hebiba mutants.[1].

Gene Symbol

  • Os03g0438100 <=> OsAOC,AOC

Function

  • OsAOC encodes a functional AOC
  • OsAOC is a functional enzyme that is involved in the biosynthesis of jasmonic acid and related compounds.

Phenotypic analysis

  • The mutant exhibited a long mesocotyl in etiolated seedlings. Furthermore, the mutant produced at most only a few fertile seeds in each panicle and is almost sterile. As the mutant was successfully pollinated by the wild-type, this feature is apparently caused by a reduction in male fertility.
  • The wild-type had a mean final coleoptile length of 6.6 mm, but cpm2 and heb- iba developed significantly longer coleoptiles (16.0 and 23.4 mm for cpm2 and hebiba, respectively). Thus, both mutants exhibit the long-coleoptile phenotype, but with different amplitude.

You can also add sub-section(s) at will.

Labs working on this gene

  • Botanical Institute, Molecular Cell Biology, Karlsruhe Institute of Technology, Kaiserstraße 2, 76131 Karlsruhe, Germany,
  • Division of Plant Sciences, National Institute of Agrobiological Sciences, 2–1–2 Kannondai, Tsukuba, Ibaraki 305–8602,Japan,
  • Botanical Gardens, Graduate School of Science, Osaka City University, Kisaichi, Katano-shi, Osaka 576–0004, Japan,
  • Biotechnology Research Center, University of Tokyo, 1–1–1 Yayoi, Bunkyo–ku, Tokyo 113–8657, Japan,
  • Rice Applied Genomics Research Unit, National Institute of Agrobiological Sciences, 2–1–2 Kannondai, Tsukuba, Ibaraki305–8602, Japan,
  • Agrigenomics Research Center, National Institute of Agrobiological Sciences, 1–2 Ohwashi, Tsukuba, Ibaraki 305–8634,Japan, and
  • Department of Biosciences, Teikyo University, 1–1 Toyosatodai, Utsunomiya 320–8551, Japan

References

  1. 1.0 1.1 Riemann M, Haga K, Shimizu T, Okada K, Ando S, Mochizuki S, Nishizawa Y, Yamanouchi U, Nick P, Yano M, Minami E, Takano M, Yamane H, Iino M. Identification of rice Allene Oxide Cyclase mutants and the function of jasmonate for defence against Magnaporthe oryzae. Plant J. 2013 Apr;74(2):226-38. doi: 10.1111/tpj.12115. Epub 2013 Mar 4. PubMed PMID: 23347338.

Structured Information