Difference between revisions of "Os03g0181100"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os03g0181100''''' was reported as '''''TIFY11b''''' in 2012 <ref name="ref1" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:131-Os03g0181100.png|right|thumb|327px|'''Figure 2.''' ''Grain Sizes for Transgenic Plants Overexpressing TIFY11b in Ripening Seeds (prolamin promoter) and in the Whole Plant Body (ubiquitin promoter) and Control Plants (vector control)..<ref name="ref1" />.'']]
 
===Function===
 
===Function===
Please input function information here.
+
* Overexpression of Rice '''''TIFY11b''''' Gene Increases Grain Size through Enhanced Accumulation of Carbohydrates in the Stem
 
+
* '''''TIFY11b''''' is a novel grain-size increasing gene.
 
===Expression===
 
===Expression===
Please input expression information here.
+
* Mature leaves (the 4th leaf from the top frag leaf) of TIFY11b-overexpressing lines were 1.09 to 1.18-fold longer than corresponding leaves of WT plants (Fig. 3A).  
 
+
* Microscopic observation of the leaf surface revealed that it was filled with cells of similar sizes among the transgenic lines and WT plants (Fig. 3B, C), suggesting that the elongation caused by the overexpression of TIFY11b was due to an increase in the number, not the size, of the cells.
===Evolution===
 
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Hokuriku Research Center, National Agricultural Research Center, 1-2-1 Inada, Joetsu, Niigata 943-0193, Japan
 +
* Division of Genome and Biodiversity Research, National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan
 +
* Division of Plant Sciences, National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Hakata M, Kuroda M, Ohsumi A, Hirose T, Nakamura H, Muramatsu M, Ichikawa H,
 +
Yamakawa H. Overexpression of a rice TIFY gene increases grain size through
 +
enhanced accumulation of carbohydrates in the stem. Biosci Biotechnol Biochem.
 +
2012;76(11):2129-34. Epub 2012 Nov 7. PubMed PMID: 23132589.
 +
</ref>
 +
</references>
 +
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 3]]
GeneName = Os03g0181100|
 
Description = ZIM domain containing protein|
 
Version = NM_001055703.1 GI:115451134 GeneID:4331834|
 
Length = 937 bp|
 
Definition = Oryza sativa Japonica Group Os03g0181100, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:4227220..4228156|
 
CDS = 4227418..4227981|
 
GCID = <gbrowseImage1>
 
name=NC_008396:4227220..4228156
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:4227220..4228156
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgatggaggggaagagcaggaggttcgcggtggcgtgcggggtgctcagccagtacgtgagggcggagcagaagatggcggcggcggcgggggcggcaccggcgagggcggtgacgacgctgagcctgatgcctggggcggaggtggtcgtcgaggaggaggagcggagggaggttggggaggaggaggcggggccagcgacggcgccggccgcgccgctgaccatcttctacggtgggaggatggtcgtcttcgaggacttccccgcggacaaggcggcggaggtgatgcgcatggcctcctccgggatggcggcggcgccggctcagcgggagggcgccgcgctcgcggacatgcccatcatgaggaaggcgtcgctgcagcggttcttcgccaagcgcaaggaccgcctcgcggcgaccaccccctacgcccgcccgtcgccggcggagaccaaggcctccgagccggaggagaagaagacgcccacctcatggctggacctcgccgcctccgcctccgccgccgcgcgccgtgacagcctcaccatcgcgctgtga</cdnaseq>|
 
AA = <aaseq>MAMEGKSRRFAVACGVLSQYVRAEQKMAAAAGAAPARAVTTLSL                    MPGAEVVVEEEERREVGEEEAGPATAPAAPLTIFYGGRMVVFEDFPADKAAEVMRMAS                    SGMAAAPAQREGAALADMPIMRKASLQRFFAKRKDRLAATTPYARPSPAETKASEPEE                    KKTPTSWLDLAASASAAARRDSLTIAL</aaseq>|
 
DNA = <dnaseqindica>199..762#gcttcctcctccttccccaacttgcctccaattccaagttccaaccctccacctccctatataacacagctcttcccaccccgtcaaatcccacgactcaaaaccaccaaaactcaccaagcaaagcaccagcgaggaagaacaagaaggaaggtgaagagaagccgcgttttgtttctcgcgaaagtgtttgttgatatggcgatggaggggaagagcaggaggttcgcggtggcgtgcggggtgctcagccagtacgtgagggcggagcagaagatggcggcggcggcgggggcggcaccggcgagggcggtgacgacgctgagcctgatgcctggggcggaggtggtcgtcgaggaggaggagcggagggaggttggggaggaggaggcggggccagcgacggcgccggccgcgccgctgaccatcttctacggtgggaggatggtcgtcttcgaggacttccccgcggacaaggcggcggaggtgatgcgcatggcctcctccgggatggcggcggcgccggctcagcgggagggcgccgcgctcgcggacatgcccatcatgaggaaggcgtcgctgcagcggttcttcgccaagcgcaaggaccgcctcgcggcgaccaccccctacgcccgcccgtcgccggcggagaccaaggcctccgagccggaggagaagaagacgcccacctcatggctggacctcgccgcctccgcctccgccgccgcgcgccgtgacagcctcaccatcgcgctgtgatctgcgcggctttgaccaaaaacgacttaagacgcgcgcgcgctctcagcgcgcaagaggattgattcactttgctcatacccatggcgacgtagagtttttaccgcttttgctatacttctttgtaaaattcgatagggagattgaattgatgggaaaccccttgtgcctgttc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055703.1 RefSeq:Os03g0181100]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 3]]
 
[[Category:Chromosome 3]]
 

Latest revision as of 15:32, 19 October 2016

The rice Os03g0181100 was reported as TIFY11b in 2012 [1] by researchers from Japan.

Annotated Information

Figure 2. Grain Sizes for Transgenic Plants Overexpressing TIFY11b in Ripening Seeds (prolamin promoter) and in the Whole Plant Body (ubiquitin promoter) and Control Plants (vector control)..[1].

Function

  • Overexpression of Rice TIFY11b Gene Increases Grain Size through Enhanced Accumulation of Carbohydrates in the Stem
  • TIFY11b is a novel grain-size increasing gene.

Expression

  • Mature leaves (the 4th leaf from the top frag leaf) of TIFY11b-overexpressing lines were 1.09 to 1.18-fold longer than corresponding leaves of WT plants (Fig. 3A).
  • Microscopic observation of the leaf surface revealed that it was filled with cells of similar sizes among the transgenic lines and WT plants (Fig. 3B, C), suggesting that the elongation caused by the overexpression of TIFY11b was due to an increase in the number, not the size, of the cells.

You can also add sub-section(s) at will.

Labs working on this gene

  • Hokuriku Research Center, National Agricultural Research Center, 1-2-1 Inada, Joetsu, Niigata 943-0193, Japan
  • Division of Genome and Biodiversity Research, National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan
  • Division of Plant Sciences, National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan

References

  1. 1.0 1.1 Hakata M, Kuroda M, Ohsumi A, Hirose T, Nakamura H, Muramatsu M, Ichikawa H, Yamakawa H. Overexpression of a rice TIFY gene increases grain size through enhanced accumulation of carbohydrates in the stem. Biosci Biotechnol Biochem. 2012;76(11):2129-34. Epub 2012 Nov 7. PubMed PMID: 23132589.


Structured Information