|
|
| (2 intermediate revisions by 2 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os11g0225100''''' was reported as '''''RGA4''''' in 2013 <ref name="ref1" /> by researchers from France and Japan. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| − | | + | ===Gene Symbol=== |
| − | Blast, caused by Magnaporthe oryzae, is one of the most widespread and destructive diseases of rice. The Oryza sativa (rice) resistance gene Pia confers resistance to the blast fungus Magnaporthe oryzae carrying the AVR-Pia avirulence gene. Pia , carried by cv. Aichi Asahi,is located on the short arm of chromosome 11.Associated with the rice leaf blast resistance which can make rice rice blast fungus produces a small species-specific resistance. Previous studies have shown that, the gene resistance spectrum of Pia is narrow, but widespread in Japanese rice varieties. the method of classical genetic is used to identify this gene. Have been cloned.(Okuyama et al., 2011)
| + | *'''''Os11g0225100''''' '''''<=>''''' '''''Pia,RGA4,Os11gRGA4''''' |
| − | | + | ===Function=== |
| − | ===Expression=== | + | * '''''RGA4''''' and '''''RGA5''''' encodes NB-LRR protein |
| − | Rice blast resistance gene Pia consists of two adjacentgenes RGA4 and RGA5 coding NBS-LRR protein.(Okuyama et al., 2011) Two NB-LRR protein-coding genes from rice (Oryza sativa), RGA4 and RGA5, were found to be required for the recognition of the Magnaporthe oryzae effector AVR1-CO39. RGA4 and RGA5 also mediate recognition of the unrelated M. oryzae effector AVR-Pia,thereby sparking an intense defense response of host plant to eliminate pathogens.
| + | * '''''RGA4''''' and '''''RGA5''''' Confer Pia and Pi-CO39 Resistance |
| − | [[File:RGA4_and_RGA5_Confer_Pi-CO39.jpg]]
| + | * '''''RGA4''''' and '''''RGA5''''' were found to be required for the recognition of the Magnaporthe oryzae effector AVR1-CO39. |
| − | | + | * '''''RGA4''''' and '''''RGA5''''' also mediate recognition of the unrelated M. oryzae effector AVR-Pia, indicating that the corresponding R proteins possess dual recognition specificity. |
| − | ===Evolution===
| + | * '''''RGA4''''' and '''''RGA5''''' interact Functionally to Recognize Two Sequence-Unrelated Effectors |
| − | | |
| − | Phylogenetic relationship of the RATX1 domains of RGA5-A, Pik-1, Pikp-1, pi5-3, and closely related homologous RATX1 proteins from rice, reconstructed using the neighbor-joining distance method based on the alignment shown in figure :Phylogenetic_analysis
| |
| − | Node supports are given in percentage of 1000 bootstrap replicates. The topology shows the condense consensus tree of the 1000 bootstrap
| |
| − | replicates, with nodes with a bootstrap support <50% being collapsed. Branch lengths are proportional to phylogenetic distances estimated from the
| |
| − | JTT + G amino acid substitution model.[[File: Phylogenetic analysis.jpg]]
| |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | 1、Biologie et Génétique des Interactions Plante-Parasite, F-34398 Montpellier, France
| + | * INRA,UMR 385 Biologie et Génétique des Interactions Plante-Parasite, F-34398 Montpellier, France |
| − | ---- | + | * CIRAD UMR Biologie et Génétique des Interactions Plante-Parasite, F-34398 Montpellier, France |
| − | | + | * CNRS, Plateforme Imagerie-Microscopie, Fédération de Recherche FR3450, 31326 Castanet-Tolosan, France |
| − | 2、Plateforme Imagerie-Microscopie, Fédération de Recherche FR3450, 31326 Castanet-Tolosan, France
| + | * INRA, UMR 441 Laboratoire des Interactions Plantes-Microorganismes, F-31326 Castanet-Tolosan, France |
| − | ----
| + | * CNRS, UMR 2594 Laboratoire des Interactions Plantes-Microorganismes, F-31326 Castanet-Tolosan, France |
| − | | + | * Iwate Biotechnology Research Center, Kitakami, Iwate 024-0003, Japan |
| − | 3、UMR 441 Laboratoire des Interactions Plantes-Microorganismes, F-31326 Castanet-Tolosan, France
| |
| − | ----
| |
| − | | |
| − | 4、UMR 2594 Laboratoire des Interactions Plantes-Microorganismes, F-31326 Castanet-Tolosan, France
| |
| − | ----
| |
| − | | |
| − | 5、Iwate Biotechnology Research Center, Kitakami, Iwate 024-0003, Japan
| |
| − | ----
| |
| − | | |
| − | 6、华南农业大学资源环境学院植物抗病遗传学研究室, 广州510642;
| |
| − | ----
| |
| − | | |
| − | 7、湖南农业大学农学院, 长沙410128
| |
| − | ----
| |
| − | | |
| − | 8、Tsukuba Botanical Garden, National Museum of Nature and Science, Tsukuba 305-0005, Japan
| |
| − | ----
| |
| − | | |
| − | 9、Graduate School of Agriculture, Hokkaido University, Sapporo 060-8589, Japan
| |
| − | ----
| |
| − | | |
| − | 10、International Rice Research Institute, MCPO Box,3127, Makati 1271, Philippines
| |
| − | ----
| |
| − | | |
| − | 11、National Agriculture Research Center,3-1-1 Kannondai, Tsukuba, Ibaraki 305-8666,Japan
| |
| − | ----
| |
| − | | |
| | ==References== | | ==References== |
| − | 1、Kiyosawa-S, Genetics of blast resistance, Rice Breeding, 1972, (0): 203-225
| + | <references> |
| − | ----
| + | * <ref name="ref1"> |
| − | 2、 Hiroshi Tsunematsu;Mary Jeanie T. Yanoria;Leodegario A. Ebron;Nagao Hayashi;Ikuo Ando;Hiroshi Kato;Tokio Imbe;Gurdev S. Khush; Development of monogenic lines of rice for blast resistance; Breeding Science, 2000, 50(3): 229-234
| + | Cesari S, Thilliez G, Ribot C, Chalvon V, Michel C, Jauneau A, Rivas S, Alaux |
| − | ----
| + | L, Kanzaki H, Okuyama Y, Morel JB, Fournier E, Tharreau D, Terauchi R, Kroj T. |
| − | 3、 曾晓珊;杨先锋;赵正洪;林菲;王玲;潘庆华, 稻瘟病抗病基因Pia的抗性分析及精细定位, 中国科学: 生命科学, 2011, 41(1): 70-77
| + | The rice resistance protein pair RGA4/RGA5 recognizes the Magnaporthe oryzae |
| − | ----
| + | effectors AVR-Pia and AVR1-CO39 by direct binding. Plant Cell. 2013 |
| − | 4、XiaoShan Zeng;XianFeng Yang;ZhengHong Zhao;Fei Lin;Ling Wang;QingHua Pan, Characterization and fine mapping of the rice blast resistance gene Pia, Science China Life Sciences, 2011, 54(4): 372-378
| + | Apr;25(4):1463-81. doi: 10.1105/tpc.112.107201. Epub 2013 Apr 2. PubMed PMID: |
| − | ----
| + | 23548743; PubMed Central PMCID: PMC3663280. |
| − | 5、Yudai Okuyama;Hiroyuki Kanzaki;Akira Abe;Kentaro Yoshida;Muluneh Tamiru;Hiromasa Saitoh;Takahiro Fujibe;Hideo Matsumura;Matt Shenton;Dominique Clark Galam;Jerwin Undan;Akiko Ito;Teruo Sone;Ryohei Terauchi, A multifaceted genomics approach allows the isolation of the rice Pia-blast resistance gene consisting of two adjacent NBS-LRR protein genes, The Plant Journal, 2011, 66(3): 467-479
| + | </ref> |
| − | ----
| + | </references> |
| − | 6、Stella Cesari;Gaëtan Thilliez;Cécile Ribot;Véronique Chalvon;Corinne Michel;Alain Jauneau;Susana Rivas;Ludovic Alaux;Hiroyuki Kanzaki;Yudai Okuyama;Jean-Benoit Morel;Elisabeth Fournier;Didier Tharreau;Ryohei Terauchi;Thomas Kroj, The Rice Resistance Protein Pair RGA4/RGA5 Recognizes the Magnaporthe oryzae Effectors AVR-Pia and AVR1-CO39 by Direct Binding, The Plant Cell, 2013, 25(4): 1463-1481
| |
| − | ----
| |
| − | | |
| − | ==Structured Information==
| |
| − | {{JaponicaGene|
| |
| − | GeneName = Os11g0225100|
| |
| − | Description = NB-ARC domain containing protein|
| |
| − | Version = NM_001189506.1 GI:297728142 GeneID:9271293|
| |
| − | Length = 4104 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os11g0225100, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
| |
| − | AP = Chromosome 11:6524851..6528954|
| |
| − | CDS = 6525228..6527270|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008404:6524851..6528954
| |
| − | source=RiceChromosome11
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008404:6524851..6528954
| |
| − | source=RiceChromosome11
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgagcaggcttgataagaactgctcaaagcaattgttgtccaagaaagcttgcccagagaggtattcacattacaagcagccagattcagcagcaattttgaagaaatgtgatggccagccacttgctcttgttaccataggtgaattcctgcaagctaatggctggccaacggggcctaactgtgaagatctctgcaatcggctacattatcacctagagaatgataaaacacttgaaaggatgcggcgagtgctggtccgcaactacactagtctacctggccatgctctcaaggcctgcttactatattttggtatgttcccatctgatcatccaatcaggaggaaaagtctgttgaggcgatggctggccgagggatttgtagaaccagtgtcttcatctagtaacctagattccacggctgctttcgatgtgctaatggaccggaacattattgagcccatcaatgtaagcaataatgataaagtcaagacatgccaaacgtacggtatgatgcgtgaattcatatcgcatatgtcaatctctcagaactttgtcacctttttctgtgatgacaagttcctgcccaaatatgttcgtcggctttctctccatggtgacactgttgtgaatggcgataacttcaacggtattgatttatcacttgtacggtctctggtagtctttggggaggcaggtacaactgtattagacttcagcaagtatcaattgctgcgagttttagatcttgaaaaatgtgatgatttgaacgatgatcatctcaaagaaatatgcaatctggtgcttctgaaatatctgagccttgggggtaatatctccaaacttccaaaggatattgccaaattgaaagatttggaggcactcgatgtaaggagatcgaaagtaaagataatgccggtagaagtcttcgggttgccatgcctaattcatctgcttggaaaatttaagctctcagataaagtcaagcagaagactgaagtgcaagagtttctctcgaaaggaaaaagcaacttgcagacgctagcaggatttgctagcaacggaagcgaagggtttctgcatcttatgaggtacatgaataagttgagaaagttgaagatttggtgtacgtcgtctgcaggtagcaccgattggactgatcttagggaggccattcaacagttcattctggatgaaaaggaagcaaatattggtacccgttctttatcgcttcatttcactggatgctctgaagatgcgataaattccttaaaagaaccctgctacctcagctcgttgaaattacatggcaacttcccccaattgcctcagtttgttacatcacttcgtggtctcaaggagctttgcctttcatctactaaatttacaacaggccttcttgaagccttgagtaatttgagctacttgcagtatctcaaactggttgccgatgaacttgagaagttcatcataaaagttcaggggttccccaggctgctatgcctttgtattgtgctacaatgtccaacattcccagtaattgaagaaggagctctgccatttcttgtcacacttcagctgctatgcaaagatctacatggcctttctgacatcaaaattgaatgttttaaacatcttcaggaggtaactcttcattctggagtcactccagctacaagacaggaatgggtaaaggctgctaaggagcatccgaataggccaaaagtattgcttctcaaatctgttgatacagcagaaagtgaacatacagacgttgatagtgtaatggaggcagtcaaaagtgagactacagaatattctattgcaccagagggaccagaacaagtgattgacatgaacaacaaaatgcaacttgaccatggattggaatcctcttctgtgctgaacaaacaaaacaattttgcagaccaatcaagctcaaaagatcaactgcattattctttcaacaatatggggctttcagatgtctctcctgctgtgagtgagctgccgaatggcatggtgccttcttgtacatga</cdnaseq>|
| |
| − | AA = <aaseq>MSRLDKNCSKQLLSKKACPERYSHYKQPDSAAILKKCDGQPLAL VTIGEFLQANGWPTGPNCEDLCNRLHYHLENDKTLERMRRVLVRNYTSLPGHALKACL LYFGMFPSDHPIRRKSLLRRWLAEGFVEPVSSSSNLDSTAAFDVLMDRNIIEPINVSN NDKVKTCQTYGMMREFISHMSISQNFVTFFCDDKFLPKYVRRLSLHGDTVVNGDNFNG IDLSLVRSLVVFGEAGTTVLDFSKYQLLRVLDLEKCDDLNDDHLKEICNLVLLKYLSL GGNISKLPKDIAKLKDLEALDVRRSKVKIMPVEVFGLPCLIHLLGKFKLSDKVKQKTE VQEFLSKGKSNLQTLAGFASNGSEGFLHLMRYMNKLRKLKIWCTSSAGSTDWTDLREA IQQFILDEKEANIGTRSLSLHFTGCSEDAINSLKEPCYLSSLKLHGNFPQLPQFVTSL RGLKELCLSSTKFTTGLLEALSNLSYLQYLKLVADELEKFIIKVQGFPRLLCLCIVLQ CPTFPVIEEGALPFLVTLQLLCKDLHGLSDIKIECFKHLQEVTLHSGVTPATRQEWVK AAKEHPNRPKVLLLKSVDTAESEHTDVDSVMEAVKSETTEYSIAPEGPEQVIDMNNKM QLDHGLESSSVLNKQNNFADQSSSKDQLHYSFNNMGLSDVSPAVSELPNGMVPSCT</aaseq>|
| |
| − | DNA = <dnaseqindica>1685..3727#gtcagtcttccccttccccagctctccatcgaatcgtagcttgttgaaggtggaagatggaggccgcgcttctgagcggattcatcaaggccatcctgccgaggctcttctccctcgtcaacgacaagctcaatctgcacaagggcgtcaagggcgacatcgatttcctcatcaaggagctccgcatgatcgtcggcgccatcgacgacgacctctccgtcgaacatggcgccgccgccgccgccgccgccgtatctccatcgaatcgtagcttgttgaaggtggaagatggaggccgcgcttctgagcggattcatcaaggccatcctgccgaggctcttctccctcgtcaacgacaagctcaatctgcacaagggcgtcaagggcgacatcgatttcctcatcaaggagctccgcatgatcgtcggcgccatcgacgacgacctctccgtcgaacatggcgccgccgccgccgccgccgccgtacagacgctatgcatggaggacctccgcgagctcgcccacggcatcgaggactgcatcgacggcgtcctgtaccgcgccgccagggagcagcggcgctcttcgtcgcttctcccccgcacggtccgggcaaccaagaagttgctacagacaaaccagcatctggcccaggagttgcagcggctgaagaggatggtggaggaggcgaaccagcggaagcagaggtacacggcggcggcgcccggtcaacacggtcaggtctactcatcggctgcggcgcaggtggatgagccgtggccgtcgtgctcatctgcctcagatccgcgcatccacgaggcggacctggtcggcgtcgacgcggaccgggcggagctccttgagcagctggcggagcggcagccggagcagctcaaggtgatcgccatcgtcgggttctgcgggctggggaagaccgccctcgccgcggaggcgtacaaccgagagacccgcggcgggagattcgagaggcacgcgtgggtttgcgccgcgcaccggagtgcacgggaggtgctcggcgaattgctccgcaggattgacgcccgcttgccatggggactccgatgctggccagctgtgtgtagatatcagacaacagttggagaagaagaggtgaaaaatctcaactttctgcttgaattgcctgatccatttttcacatgaatttgaggtcaacattttagtcaactcgcctgttcttttgcacaagttcagtgcgactgacactttcaatagcaaagtgaatcatgaacagatactatatcttgctaactgctaggtgttagctgcactaatttagtcatcaaatgcatacagtgcatttctcatgcgctttatcttttacaaatttactataatagaataaaaatggaaaaaacaattcactgcttctaaattgctctaccgtatgaaattatacaaattattcgtttcaatttgttgattactgtggctccagatggggatgtttacaattattctttcttgatctgcctcgtcttgcaggtacttcattgttatcgatgacattcaaacagaagatcagtggaaaagcatcaaatcggcttttccgactgataaggatattggcagcagaatagtggtcacgacgaccatccagtcagtagctaatgcctgctgttctgcgaatgggtatttgcacaaaatgagcaggcttgataagaactgctcaaagcaattgttgtccaagaaagcttgcccagagaggtattcacattacaagcagccagattcagcagcaattttgaagaaatgtgatggccagccacttgctcttgttaccataggtgaattcctgcaagctaatggctggccaacggggcctaactgtgaagatctctgcaatcggctacattatcacctagagaatgataaaacacttgaaaggatgcggcgagtgctggtccgcaactacactagtctacctggccatgctctcaaggcctgcttactatattttggtatgttcccatctgatcatccaatcaggaggaaaagtctgttgaggcgatggctggccgagggatttgtagaaccagtgtcttcatctagtaacctagattccacggctgctttcgatgtgctaatggaccggaacattattgagcccatcaatgtaagcaataatgataaagtcaagacatgccaaacgtacggtatgatgcgtgaattcatatcgcatatgtcaatctctcagaactttgtcacctttttctgtgatgacaagttcctgcccaaatatgttcgtcggctttctctccatggtgacactgttgtgaatggcgataacttcaacggtattgatttatcacttgtacggtctctggtagtctttggggaggcaggtacaactgtattagacttcagcaagtatcaattgctgcgagttttagatcttgaaaaatgtgatgatttgaacgatgatcatctcaaagaaatatgcaatctggtgcttctgaaatatctgagccttgggggtaatatctccaaacttccaaaggatattgccaaattgaaagatttggaggcactcgatgtaaggagatcgaaagtaaagataatgccggtagaagtcttcgggttgccatgcctaattcatctgcttggaaaatttaagctctcagataaagtcaagcagaagactgaagtgcaagagtttctctcgaaaggaaaaagcaacttgcagacgctagcaggatttgctagcaacggaagcgaagggtttctgcatcttatgaggtacatgaataagttgagaaagttgaagatttggtgtacgtcgtctgcaggtagcaccgattggactgatcttagggaggccattcaacagttcattctggatgaaaaggaagcaaatattggtacccgttctttatcgcttcatttcactggatgctctgaagatgcgataaattccttaaaagaaccctgctacctcagctcgttgaaattacatggcaacttcccccaattgcctcagtttgttacatcacttcgtggtctcaaggagctttgcctttcatctactaaatttacaacaggccttcttgaagccttgagtaatttgagctacttgcagtatctcaaactggttgccgatgaacttgagaagttcatcataaaagttcaggggttccccaggctgctatgcctttgtattgtgctacaatgtccaacattcccagtaattgaagaaggagctctgccatttcttgtcacacttcagctgctatgcaaagatctacatggcctttctgacatcaaaattgaatgttttaaacatcttcaggaggtaactcttcattctggagtcactccagctacaagacaggaatgggtaaaggctgctaaggagcatccgaataggccaaaagtattgcttctcaaatctgttgatacagcagaaagtgaacatacagacgttgatagtgtaatggaggcagtcaaaagtgagactacagaatattctattgcaccagagggaccagaacaagtgattgacatgaacaacaaaatgcaacttgaccatggattggaatcctcttctgtgctgaacaaacaaaacaattttgcagaccaatcaagctcaaaagatcaactgcattattctttcaacaatatggggctttcagatgtctctcctgctgtgagtgagctgccgaatggcatggtgccttcttgtacatgacaaggatctagaatcttcacgtggcttcccggtcagttatttggacctgttgctttctgattgtgcattttgtgtttacttgtccttcacacaatcatcgtcatcaaaatacctttgatttcctacactccctgttacctcccttgatgaaatcagggggattcatgggcacagctacatgttctgtctgcattttgtatagtgacgtggcatacctagtacttgttttgtctccatcctgtttggcagagcaacaggttgtaataaatcttggttctaactggctgccctcagaatatgttgtctatagaatccacctgatagggaattcggccgtttgataatcctttatttttaagtctattgtttgtcctgag</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189506.1 RefSeq:Os11g0225100]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
| Line 102: |
Line 36: |
| | [[Category:Japonica Chromosome 11]] | | [[Category:Japonica Chromosome 11]] |
| | [[Category:Chromosome 11]] | | [[Category:Chromosome 11]] |
| | + | ==Structured Information== |