Difference between revisions of "Os07g0466300"

From RiceWiki
Jump to: navigation, search
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os07g0466300''''' was reported as '''''Rurm1''''' in 2010<ref name="ref1" /> and 2013 <ref name="ref2" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:150-Os07g0466300-1.png|right|thumb|427px|'''Figure 1.''' ''Organ- and Developmental Stage-Specific Expression Patterns of the Rurm1 Gene.<ref name="ref1" />.'']]
 +
===Gene Symbol===
 +
*'''''Os07g0466300''''' '''<=>''' '''''Rurm1,slg'''''
 
===Function===
 
===Function===
Please input function information here.
+
* '''''Rurm1''''' is a gene encoding ubiquitin-like protein markedly enhances the transposition activity of a MITE mPing in intact rice plants without any exogenous stresses.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* Real-time PCR using specific primers for Rurm1 (5 0 -CTGGGAGCTATGCGGTGG-3 and 5-CGT-GTAATGTGGAGATAAAAACAACA-3 0 ) revealed that Rurm1 expressed in all organs through all developmental stages, although the root showed the lowest transcript level of Rurm1 at all developmental stages (Fig. 1).
 
+
* Moreover, it was found that Rurm1 most actively expressed in the meristem at 30 d after sowing (DAS).
===Evolution===
 
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Division of Agronomy and Horticulture Science, Graduate School of Agriculture, Kyoto University, Kitashirakawa, Sakyo, Kyoto 606–8502, Japan
 +
* Division of Food Science and Biotechnology, Graduate School of Agriculture, Kyoto University, Kyoto 606-8502, Japan
 +
* Faculty of Biology-Oriented Science and Technology, Kinki University, Kinokawa, Wakayama 649–6433, Japan
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Tsukiyama T, Lee J, Okumoto Y, Teraishi M, Tanisaka T, Inouye K. Gene cloning,
 +
bacterial expression, and purification of a novel rice (Oryza sativa L.)
 +
ubiquitin-related protein, RURM1. Biosci Biotechnol Biochem. 2010;74(2):430-2.
 +
Epub 2010 Feb 7. PubMed PMID: 20139593.
 +
</ref>
 +
* <ref name="ref2">
 +
Tsukiyama T, Teramoto S, Yasuda K, Horibata A, Mori N, Okumoto Y, Teraishi M,
 +
Saito H, Onishi A, Tamura K, Tanisaka T. Loss-of-function of a ubiquitin-related
 +
modifier promotes the mobilization of the active MITE mPing. Mol Plant. 2013
 +
May;6(3):790-801. doi: 10.1093/mp/sst042. Epub 2013 Feb 27. PubMed PMID:
 +
23446031.
 +
</ref>
 +
 
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 7]]
GeneName = Os07g0466300|
 
Description = Similar to Rurm1 protein|
 
Version = NM_001066123.1 GI:115471978 GeneID:4343175|
 
Length = 1552 bp|
 
Definition = Oryza sativa Japonica Group Os07g0466300, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
 
AP = Chromosome 7:17182612..17184163|
 
CDS = 17182812..17182929,17183611..17183693,17183816..17183894,17184006..17184028|
 
GCID = <gbrowseImage1>
 
name=NC_008400:17182612..17184163
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008400:17182612..17184163
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgcatctaaccctcgaattcgggggagggctggagctgctcctggagaagtccaccaaggtgcacaaggtggacctccagcccaacgacggcgatgggaaggtcgtgatgaaagggttgctcgcttgggtgaagtccaatctgatcaaggagaggccggagatgttcctcaagggtgattcagtaaggcctggtgttctcgtacttataaatgattgtgactgggagctatgcggtggccttgacgcggagttggaggagaaggatgttgttgtttttatctccacattacacggtggttag</cdnaseq>|
 
AA = <aaseq>MHLTLEFGGGLELLLEKSTKVHKVDLQPNDGDGKVVMKGLLAWV                    KSNLIKERPEMFLKGDSVRPGVLVLINDCDWELCGGLDAELEEKDVVVFISTLHGG</aaseq>|
 
DNA = <dnaseqindica>1235..1352#471..553#270..348#136..158#attccccaccgccgccgccgccgtctactcgctctcgccgccgcccgcgactcccccctcctcggccgctcgcaccctcgccgcgtcgacgctcgatcgctgttcgcgcttcgcctcctcccaatcctctccgccatgcatctaaccctcgaattcgggtgggtgattcactctctctctctcgatgccttccatcgttgtgttgctgctgtgtattttgtggttgctgatgagctgtgtgggttgattgatggtggtggtggttgcaggggagggctggagctgctcctggagaagtccaccaaggtgcacaaggtggacctccagcccaacgacggcgatgggaaggtgacgcccgcccgcctcgacggagccgcgccgcgtgcagctactgcttagctaatcacggacttagaattctgagctgtttgtgtgtgaacattttctttgttgtttgtttcgttttgcaggtcgtgatgaaagggttgctcgcttgggtgaagtccaatctgatcaaggagaggccggagatgttcctcaagggtgattcagtgtatgattttccctttccgtctcatggtttatgtgcatgatatgatttgatccgcttcaatgatcaatggtgtgtccaaagcattttatttgttttcggtccacttcggtatggatattgctaggtgatgagtggtgtcgcttctttggtgatgctggctgttatttctgctgaatttcaacttaaccatgcaaacttaagttataggagaaatgctcaaatattttatttctgttatttcgttaaaaatgtttgtcattgtttctggagctacttcctccgtttcacaacgtaattcataaatgtgggaaatgctagaatgacttacgttgtgaaacggatggagtaaatgttaaatatgcaaccttctaatgacagtttagttgatttcattagaaatatgcataatgaactagggttattgatccggtgattttacttgaataaggaaaccttctaatgacagtttagtatgtgcttatgaatgctttgggtggtatacaggttatttgctgttttctttgcagagaagtggatgctttgttagcgcaataagctgggggatatcattaaacttttgcaatgtcaaacttgaaggaaatttagaaattctctttctttaatttgtggacaaagttaagtccattagtcttgatgaggtgcttcttttcgtgcttgcagaaggcctggtgttctcgtacttataaatgattgtgactgggagctatgcggtggccttgacgcggagttggaggagaaggatgttgttgtttttatctccacattacacggtggttagtacaactattaggactaccgaaatcaccactgatatcatgttgctaaatgcatcttgtaccatcagaaacagaggttgtgtgccataaatttctggagagaatggattgtggagaggaatctgctgaagttgatatggtcaatttctgtaatgaaaaggcagttgtcagttatgaatattcaatatcacagatttgcagt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001066123.1 RefSeq:Os07g0466300]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 7]]
 
[[Category:Chromosome 7]]
 

Latest revision as of 04:23, 21 October 2016

The rice Os07g0466300 was reported as Rurm1 in 2010[1] and 2013 [2] by researchers from Japan.

Annotated Information

Figure 1. Organ- and Developmental Stage-Specific Expression Patterns of the Rurm1 Gene.[1].

Gene Symbol

  • Os07g0466300 <=> Rurm1,slg

Function

  • Rurm1 is a gene encoding ubiquitin-like protein markedly enhances the transposition activity of a MITE mPing in intact rice plants without any exogenous stresses.

Expression

  • Real-time PCR using specific primers for Rurm1 (5 0 -CTGGGAGCTATGCGGTGG-3 and 5-CGT-GTAATGTGGAGATAAAAACAACA-3 0 ) revealed that Rurm1 expressed in all organs through all developmental stages, although the root showed the lowest transcript level of Rurm1 at all developmental stages (Fig. 1).
  • Moreover, it was found that Rurm1 most actively expressed in the meristem at 30 d after sowing (DAS).

You can also add sub-section(s) at will.

Labs working on this gene

  • Division of Agronomy and Horticulture Science, Graduate School of Agriculture, Kyoto University, Kitashirakawa, Sakyo, Kyoto 606–8502, Japan
  • Division of Food Science and Biotechnology, Graduate School of Agriculture, Kyoto University, Kyoto 606-8502, Japan
  • Faculty of Biology-Oriented Science and Technology, Kinki University, Kinokawa, Wakayama 649–6433, Japan

References

  1. 1.0 1.1 Tsukiyama T, Lee J, Okumoto Y, Teraishi M, Tanisaka T, Inouye K. Gene cloning, bacterial expression, and purification of a novel rice (Oryza sativa L.) ubiquitin-related protein, RURM1. Biosci Biotechnol Biochem. 2010;74(2):430-2. Epub 2010 Feb 7. PubMed PMID: 20139593.
  2. Tsukiyama T, Teramoto S, Yasuda K, Horibata A, Mori N, Okumoto Y, Teraishi M, Saito H, Onishi A, Tamura K, Tanisaka T. Loss-of-function of a ubiquitin-related modifier promotes the mobilization of the active MITE mPing. Mol Plant. 2013 May;6(3):790-801. doi: 10.1093/mp/sst042. Epub 2013 Feb 27. PubMed PMID: 23446031.

Structured Information