Difference between revisions of "Os03g0722400"

From RiceWiki
Jump to: navigation, search
(Expression)
(Annotated Information)
 
(13 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os03g0722400''''' was reported as '''''OsDDM1b''''' in 2012 <ref name="ref1" /> by researchers from Japan.  
 
 
OsDDM1b
 
The rice semidwarf-1 (sd1) gene is well known as the "green revolution gene" and controls the plant height of rice.
 
 
==Annotated Information==
 
==Annotated Information==
 
+
[[File:155-Os03g0722400.png|right|thumb|327px|'''Figure 1.''' ''Expression of OsDDM1 genes during development..<ref name="ref1" />.'']]
 
+
===Gene Symbol===
 +
*'''''Os03g0722400''''' '''''<=>''''' '''''OsDDM1b'''''
 
===Function===
 
===Function===
OsDDM1b is required for the maintenance of DNA methylation on newly replicated
+
* '''''OsDDM1''''' genes function to silence endogenous loci including those related to retrotransposons in the rice genome, however, their roles on transposition of active.
DNA strands in rice genome like OsDDM1a.It mainly keeps the methylation level on  
+
transposons in the genome remains unknown.
repeated sequences rather than single copy sequence.
+
* Hypomethylation induced by the antisense '''''OsDDM1''''' disturbs normal development.
 
 
===Mutant Phenotype===
 
We can observe dwarf phenotypes in OsDDM1 mutant lines generated through the antisense technology. Except the dwarf phenotypes, no other significant specific morphological aberration was observed in independent OsDDM1 mutant lines. However, in some sublines, researchers observed reduced fertility relative to normal lines.
 
 
 
[[File:dwarf phenotype.jpg|150px]]
 
 
 
 
===Expression===
 
===Expression===
Cytosine methylation in the plant genome is very important in establishing the epigenetic states of chromosome regions. The Decrease
+
* '''''OsDDM1a''''' and '''''OsDDM1b''''' are expressed during development with slight variations among various tissues, suggesting that there might be functional divergence of these two genes (Fig. 1c).
in DNA Methylation 1 (DDM1) in Arabidopsis thaliana is one of the best well-studyed plant epigenetic regulators for maintenance of
 
cytosine methylation in genomic DNA. Higo, Hiromi, et al identified two rice genes with high similarity to Arabidopsis DDM1 and
 
designated them OsDDM1a and OsDDM1b. Both of the rice DDM1 homologs are transcribed during development and their amino acid sequences
 
are 93 % identical to each other. Transgenic rice lines silencing the OsDDM1 exhibited genomic DNA hypomethylation.And in those mutant
 
lines, repeated sequences were more severely affected than a single copy sequence. Transcripts derived from endogenous transposon-
 
related loci were up-regulated in the antisense OsDDM1 lines.OsDDM1a and OsDDM1b are expressed during development with slight
 
variations among various tissues, suggesting that there might be functional divergence of these two genes.
 
 
 
[[File:expression.jpg|300px]]
 
 
 
===Evolution===
 
OsDDM1b(Os03g0722400) is 93% identical to another gene OsDDM1a(Os09g0442700) in the
 
predicted amino acid sequences and shows 60 % identity to Arabidopsis DDM1. However, considering maize, no simple orthologous relationships
 
exits between the two maize DDM1-like genes-CHR101,CHR106 and OsDDM1.OsDDM1b and OsDDM1a both consist of 15 exons and 14 introns and the DNA
 
sequence similarity shared by these two genes is 81%, even including
 
intron sequences. Compared to the Arabidopsis DDM1, these two genes' exon–intron structure  is similar.
 
The start codon of the Arabidopsis DDM1 locates in the first exon, but it is in the second exon for the
 
OsDDM1 genes.
 
The protein product of OsDDM1b gene is 849 amino acids in length.
 
Both rice OsDDM1a and OsDDM1b proteins contain the eight signature
 
amino acid motifs diagnostic for SWI2/SNF2 proteins.
 
 
 
 
 
[[File:Osddm1a.jpg|300px]] [[File:E_1.jpg|700px]]
 
 
 
(Higo, Hiromi, et al.,2012)
 
 
 
By comparing the DDM1-like prteins encoded in the maize genome,Arabidopsis DDM1 and the mouse LSH with the two rice DDM1-like proteins,the envolution relationship is showed as below.We can see that they appear to have arisen by a relatively recent
 
duplication event.
 
 
 
[[File:E_2.jpg|500px|]]
 
 
 
(Higo, Hiromi, et al.,2012)
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
 +
* CREST, Japan Science and Technology Agency,Kawaguchi 332-0012, Japan
 +
* Department of Molecular Genetics, National Institute of Agrobiological Sciences, Tsukuba 305-8602, Japan
 +
* Department of Plant Science, University of Manitoba,Winnipeg R3T 2N2, Canada
 +
* Department of Integrated Genetics, National Institute of Genetics, Mishima 411-0801, Japan
  
CREST, Japan Science and Technology Agency,Kawaguchi 332-0012, Japan
+
==References==
 
+
<references>
Department of Molecular Genetics, National Institute of Agrobiological Sciences, Tsukuba 305-8602, Japan
+
* <ref name="ref1">
 +
Higo H, Tahir M, Takashima K, Miura A, Watanabe K, Tagiri A, Ugaki M, Ishikawa
 +
R, Eiguchi M, Kurata N, Sasaki T, Richards E, Takano M, Kishimoto N, Kakutani T,  
 +
Habu Y. DDM1 (decrease in DNA methylation) genes in rice (Oryza sativa). Mol
 +
Genet Genomics. 2012 Oct;287(10):785-92. Epub 2012 Aug 24. PubMed PMID: 22915302.
 +
</ref>
 +
</references>
  
Department of Plant Science, University of Manitoba, Winnipeg R3T 2N2, Canada
 
 
Department of Integrated Genetics,National Institute of Genetics, Mishima 411-0801, Japan
 
 
Experimental Farm, National Institute of Genetics, Mishima 411-0801, Japan
 
 
==References==
 
Higo, Hiromi, et al. "DDM1 (Decrease in DNA Methylation) genes in rice (Oryza sativa)." Molecular Genetics and Genomics 287.10 (2012): 785-792.
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os03g0722400|
 
Description = Conserved hypothetical protein|
 
Version = NM_001057645.2 GI:297601601 GeneID:4333943|
 
Length = 3180 bp|
 
Definition = Oryza sativa Japonica Group Os03g0722400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:30070286..30073465|
 
CDS = 30072187..30072291|
 
GCID = <gbrowseImage1>
 
name=NC_008396:30070286..30073465
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:30070286..30073465
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgaatatctttattctaagcacacgggctggtgggctgggtatcaatcttacttcggctgatacctgtatcctatatgatagtgactgggtaattccctattga</cdnaseq>|
 
AA = <aaseq>MNIFILSTRAGGLGINLTSADTCILYDSDWVIPY</aaseq>|
 
DNA = <dnaseqindica>1902..2006#aggggcatcggctaaagaattcaaagtgcatattattaagggagttaaagcgcctgccaatggataataagctccttttgactggaacacctcttcagaataatctagcagaactgtggtcactgctgaacttcattttgcctgatatattctcatcgcatcaggagttcgagtcatggtatgatccattttgctgagtatattccttctcaagtgtggtttgtgcttttatactatcacgtctcagcagtcagcactaaagtacaaatatgatagtataattgaagattttcttatcatgcactcgttcctatatccatcttaacctttccgtcaaataattgtttgtctcacttttgagtcattttcctgactgtttattgtcaacttcgttcatttgtatatgcattgagcagagcagatagtcttcttctcttcaagacaagacatttgtcaggatctctctaggtcattgagggctagcatattggtcaaaacaatgtaaaagaacctcttaaactgcataacagcaatttcaacactaatctcatcaactaaccctgtttatgtatatagttattccattagtttgttgctactcttaagacgtggctttattttttttctcattggcttgcctttatgaagtgtcgtaaagttgaatgccctatgtgttgtagcggttatgcatattgctttgatatgcgatgtctgctaacgtgtcttttgaatgtagcacaaatctatgctgtacatctactgatttatttggtgtttactgggatgctatgtttacttttgtgtctgccttatgtctgttgtacaggtttgatttttgtgcaaaagggggtgaagaagaacaagaggaaagtgaagagaagagaaaagtcgatgttgtttcaaagcttcatgccatattgcgccccttccttctaaggcggatgaaggaggatgtagagcatatgcttccacgaaagaaagagataatcatttatgctaacatgactaaccatcagaaagaaatccagaatcacttggttgaacaaacatttgatgaatacctgcatgaaaaatcagaaattggtacggatgcttgtgcacatagtctcctacatacattcctgttgacttaaaaagttaatctgacaagtgctgaggagtattgcagttctgcggagacctggcattaaggcgaagctgaataaccttttaattcaactgaggaaaaattgcaaccatcctgatcttttggagtccgcatatgactcatcaggttgttccacattggacatctgtagttaattgcttcacgtgctcatttcctaacatttttgtttttttttctttctgtaggtatgtacccacctgttgagaagctcttagaacaatgcggtaaatttcagctcttgaacagattgctaaatttgctgcttgcacggaagcacaaggtatatcattttctctgctattctgtttaattcaggattacattaatgcaaatgttagctcaaactttttttgaagaaaaaaaatcatagacctcaactggcgttctttgtaggttctaatattttcacagtggacaaaagttttggacattatcgagtactacttggaaacaaaaggccttcaggtttgccgaattgatggcagtgttaagttggaagagaggaggaggcaggtaaagcgggctgtgccaagcattgccgattaccatataatgtgtaaagttctagtcttctagatgcatataggctgactgcgctatcttaaaatacaattaggagtctcattttttcgccattgttatcttttatcatccattttaatgtaatacagttctcacaattttgtgcactattctcttgcagatagcagaatttaatgacttgaacagcagcatgaatatctttattctaagcacacgggctggtgggctgggtatcaatcttacttcggctgatacctgtatcctatatgatagtgactgggtaattccctattgacattattttacttcttcagactaaatattcatattatagcaagtacattgcaagattcttttgcatgccatccacctgttcgaacaggtggaatgtaggcatgtagactttaccttctattagctgattatgtgaattgttaaacttctgccatcattctgcagaatcctcagatggatttgcaggccatggatcgatgccaccggattggtcaaacacgcccagttcacgtctaccggttggcaacatcacattctgttgaggtgtgtcggatgatctttttgtctttagacatcggctacaccacctgttgtatagttgctcatcttaatggtgttgcagggccggatcatcaagaaagcatttggaaagttgaggctggaacatgtggtgatcgggaagggtcagtttgaacaagacagagccaaacctaatgcactagacgtaaatgttcccatccatcctcctgagtcctgactattaagataactactctttgttcacacttttttttggaaaacaagttctttcttcatagaggaacaccatatgaacaaatctacaaaattgacactgaaagaatgtccaccccgcggaaaatcctcatctcatattttccatttcttgtgattatgcaggaggcggagttgctggcgctgctcagggacgagcaggacgaggaggaccggatgatccagacggacatcaccgacgaggatctcctgaaggtgatggaccggagcgaccttacaggccctcctgccaacgccgacgccgcccctctcgtgcccctgaagggacccggctgggaggtggtggtgccgacgaagagcggcggcggcatgctcacgtcgctcaccagctagctgctttctttcatcgctcgctgcgcacctcaggccatagccctagtaaggctgccggctaaggtgcctcttgagctgtgctgcatctgctgatgagacgacgcttttgtgatcccaccccaagtaattactgactgggcattgcacttgcgccagtacactaggaagtgataaggtagtgtgcatctaatctgtcgtaagtatctctgttgttggctcagctgctgcatttcattttgcaaggcccaaagccttttctagaatgctagtgtaagaacgtggtatttgagaacataatatccttgtct</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057645.2 RefSeq:Os03g0722400]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 13:31, 21 October 2016

The rice Os03g0722400 was reported as OsDDM1b in 2012 [1] by researchers from Japan.

Annotated Information

Figure 1. Expression of OsDDM1 genes during development..[1].

Gene Symbol

  • Os03g0722400 <=> OsDDM1b

Function

  • OsDDM1 genes function to silence endogenous loci including those related to retrotransposons in the rice genome, however, their roles on transposition of active.

transposons in the genome remains unknown.

  • Hypomethylation induced by the antisense OsDDM1 disturbs normal development.

Expression

  • OsDDM1a and OsDDM1b are expressed during development with slight variations among various tissues, suggesting that there might be functional divergence of these two genes (Fig. 1c).

Labs working on this gene

  • CREST, Japan Science and Technology Agency,Kawaguchi 332-0012, Japan
  • Department of Molecular Genetics, National Institute of Agrobiological Sciences, Tsukuba 305-8602, Japan
  • Department of Plant Science, University of Manitoba,Winnipeg R3T 2N2, Canada
  • Department of Integrated Genetics, National Institute of Genetics, Mishima 411-0801, Japan

References

  1. 1.0 1.1 Higo H, Tahir M, Takashima K, Miura A, Watanabe K, Tagiri A, Ugaki M, Ishikawa R, Eiguchi M, Kurata N, Sasaki T, Richards E, Takano M, Kishimoto N, Kakutani T, Habu Y. DDM1 (decrease in DNA methylation) genes in rice (Oryza sativa). Mol Genet Genomics. 2012 Oct;287(10):785-92. Epub 2012 Aug 24. PubMed PMID: 22915302.


Structured Information