Difference between revisions of "Os03g0819600"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
 
(7 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os03g0819600''''' was reported as '''''gh1''''' in 2012 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os03g0819600''''' '''''<=>''''' '''''gh1,OsCHI,Cfi,CHI'''''
 
===Function===
 
===Function===
Please input function information here.
+
* '''''OsCHI''''' encodes a protein functionally and structurally conserved to chalcone isomerases in other species.
 +
* The '''''OsCHI''''' gene was indispensable for flux of the flavonoid pathway in rice.
 +
 
 +
===Phenotypic analysis===
 +
* Compared to the wild-type variety Zhefu802 (an indica cultivar), gh1 exhibited an obvious golden pigmentation in the panicle and internode at maturity, while coloration of the hull was the most significant phenotype (Fig 2a, b).
 +
* As shown in Fig. 2c, gh1 panicles before heading were not significantly different from wild-type panicles at the same stage. Once the panicles grew out of the sheaths, golden pigmentation of hulls occurred conspicuously in gh1 panicles, exhibiting a marked difference from the green wild-type panicles (Fig. 2d).
 +
* Visual inspection of cross sections of wild-type and gh1 spikelets at the heading stages revealed that the pigments in gh1 hulls were deposited mainly in the epidermal layer and the underlying parenchyma cells (Fig. 2e, f).
 +
 
 +
 
 +
[[File:156-Os03g0819600.png|center|thumb|727px|'''Figure 2.''' ''Pigmented hulls and internodes of the gh1 mutant.<ref name="ref1" />.'']]
  
===Expression===
 
Please input expression information here.
 
  
===Evolution===
 
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* State Key Laboratory of Plant Genomics, Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, People's Republic of China
 +
* State Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou 310006, People's Republic of China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Hong L, Qian Q, Tang D, Wang K, Li M, Cheng Z. A mutation in the rice chalcone
 +
isomerase gene causes the golden hull and internode 1 phenotype. Planta. 2012
 +
Jul;236(1):141-51. doi: 10.1007/s00425-012-1598-x. PubMed PMID: 22286805.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 3]]
GeneName = Os03g0819600|
 
Description = Chalcone isomerase (EC 5.5.1.6)|
 
Version = NM_001058249.1 GI:115456226 GeneID:4334588|
 
Length = 1131 bp|
 
Definition = Oryza sativa Japonica Group Os03g0819600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:35245241..35246371|
 
CDS = 35245359..35245577,35245659..35245882,35245959..35246120,35246218..35246314|
 
GCID = <gbrowseImage1>
 
name=NC_008396:35245241..35246371
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:35245241..35246371
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcggccgtgtcggaggtggaggtcgacggcgtcgtgttcccgccggtggcccgcccgccgggctccggccacgcccacttcctcgccggcgcaggtgtgaggggagtggagatcgccggcaacttcatcaagttcacggccatcggcgtgtacctggaggagggcgcggccgtgccggcgctggccaagaagtgggccggcaagtccgccgacgagctcgccgccgacgccgccttcttccgcgacgtcgtcaccggcgatttcgagaagttcacgagggtgacgatgatcctgccgctcaccggcgagcagtactcggacaaggtgacggagaactgcgtcgcggcgtggaaggccgccggcgtgtacacggacgccgagggcgcggccgcggacaagttcaaggaggccttcaagccccacagcttccctccgggcgcgtccatcctcttcacccactccccgcccggcgtcctcaccgtcgcgttctccaaggactcgtcggtgccagagggcgccgtggcggcggcggcgatcgagaacagggcgctctgcgaggcggtgctggattccatcatcggcgagcacggggtctcgccggcggcgaagcggagcatagcggcccgcgtctcgcagctcctgaaggcggaatccaccggcgacgtggcggcggcggagcccgcgccggtgtccgcgtga</cdnaseq>|
 
AA = <aaseq>MAAVSEVEVDGVVFPPVARPPGSGHAHFLAGAGVRGVEIAGNFI                    KFTAIGVYLEEGAAVPALAKKWAGKSADELAADAAFFRDVVTGDFEKFTRVTMILPLT                    GEQYSDKVTENCVAAWKAAGVYTDAEGAAADKFKEAFKPHSFPPGASILFTHSPPGVL                    TVAFSKDSSVPEGAVAAAAIENRALCEAVLDSIIGEHGVSPAAKRSIAARVSQLLKAE                    STGDVAAAEPAPVSA</aaseq>|
 
DNA = <dnaseqindica>795..1013#490..713#252..413#58..154#acaaaatttgtctccacgttttcttggatagttagttgctcacccgatcctgtatccatggcggccgtgtcggaggtggaggtcgacggcgtcgtgttcccgccggtggcccgcccgccgggctccggccacgcccacttcctcgccggcgcaggtttgtttgtgtttgcgttgtgtgttccgtgtcagtggagaagtggaaatgccgtgcaagcgaacttgcttgctggtttgatcgatccgtcgtgcaggtgtgaggggagtggagatcgccggcaacttcatcaagttcacggccatcggcgtgtacctggaggagggcgcggccgtgccggcgctggccaagaagtgggccggcaagtccgccgacgagctcgccgccgacgccgccttcttccgcgacgtcgtcaccggtaactcatctcgctaaatttgttgctcgtgtcgacgggcggcgcgacatgacatgggcgtcgtctcgcgttgcaggcgatttcgagaagttcacgagggtgacgatgatcctgccgctcaccggcgagcagtactcggacaaggtgacggagaactgcgtcgcggcgtggaaggccgccggcgtgtacacggacgccgagggcgcggccgcggacaagttcaaggaggccttcaagccccacagcttccctccgggcgcgtccatcctcttcacccactccccgcccggcgtcctcaccgtgagcaccaatccgttgttgccgattactccgatgcgtgatttgcttcgtgatttggactccgtttgattcgatttgcaggtcgcgttctccaaggactcgtcggtgccagagggcgccgtggcggcggcggcgatcgagaacagggcgctctgcgaggcggtgctggattccatcatcggcgagcacggggtctcgccggcggcgaagcggagcatagcggcccgcgtctcgcagctcctgaaggcggaatccaccggcgacgtggcggcggcggagcccgcgccggtgtccgcgtgaaaatcgagctgcgaattaaccgcgcatctaagagctcctcctacacttcttgtacacttctactgccctcgtgtttgacaatgaaataaaaggaaaggagaaatcgcggctgttcttc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001058249.1 RefSeq:Os03g0819600]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 3]]
 
[[Category:Chromosome 3]]
 

Latest revision as of 14:00, 21 October 2016

The rice Os03g0819600 was reported as gh1 in 2012 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os03g0819600 <=> gh1,OsCHI,Cfi,CHI

Function

  • OsCHI encodes a protein functionally and structurally conserved to chalcone isomerases in other species.
  • The OsCHI gene was indispensable for flux of the flavonoid pathway in rice.

Phenotypic analysis

  • Compared to the wild-type variety Zhefu802 (an indica cultivar), gh1 exhibited an obvious golden pigmentation in the panicle and internode at maturity, while coloration of the hull was the most significant phenotype (Fig 2a, b).
  • As shown in Fig. 2c, gh1 panicles before heading were not significantly different from wild-type panicles at the same stage. Once the panicles grew out of the sheaths, golden pigmentation of hulls occurred conspicuously in gh1 panicles, exhibiting a marked difference from the green wild-type panicles (Fig. 2d).
  • Visual inspection of cross sections of wild-type and gh1 spikelets at the heading stages revealed that the pigments in gh1 hulls were deposited mainly in the epidermal layer and the underlying parenchyma cells (Fig. 2e, f).


Figure 2. Pigmented hulls and internodes of the gh1 mutant.[1].


You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Plant Genomics, Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, People's Republic of China
  • State Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou 310006, People's Republic of China

References

  1. 1.0 1.1 Hong L, Qian Q, Tang D, Wang K, Li M, Cheng Z. A mutation in the rice chalcone isomerase gene causes the golden hull and internode 1 phenotype. Planta. 2012 Jul;236(1):141-51. doi: 10.1007/s00425-012-1598-x. PubMed PMID: 22286805.

Structured Information