|
|
| (One intermediate revision by one other user not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os04g0576900''''' was reported as '''''XIAO''''' in 2012 <ref name="ref1" /> by researchers from China. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os04g0576900''''' '''''<=>''''' '''''XIAO,OsXIAO''''' |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| + | * '''''XIAO''''' is predicted to encode an LRR kinase. |
| − | | + | * '''''XIAO''''' may provide a possible connection between BRs and cell-cycle regulation in controlling organ growth. |
| | ===Expression=== | | ===Expression=== |
| − | Please input expression information here.
| + | * T-DNA insertion mutant for organ size, referred to as xiao, that displays dwarfism and erect leaves, typical BR-related phenotypes, together with reduced seed setting. |
| − | | + | * The small stature of the xiao mutant resulted from reduced organ sizes due to decreased cell numbers resulting from reduced cell division rate, as supported by the observed coexpression of XIAO with a number of genes involved in cell cycling. |
| − | ===Evolution===
| + | * The xiao mutant displayed a tissue-specific enhanced BR response and greatly reduced BR contents at the whole-plant level |
| − | Please input evolution information here.
| |
| | | | |
| | You can also add sub-section(s) at will. | | You can also add sub-section(s) at will. |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | * National Key Laboratory of Crop Genetic Improvement and National Center of Plant Gene Research, Huazhong Agricultural University, Wuhan 430070, China |
| | + | * Department of Life Science, Chung-Ang University, Seoul 156-756, South Korea |
| | + | ==References== |
| | + | |
| | + | <references> |
| | + | * <ref name="ref1"> |
| | + | Jiang Y, Bao L, Jeong SY, Kim SK, Xu C, Li X, Zhang Q. XIAO is involved in the |
| | + | control of organ size by contributing to the regulation of signaling and |
| | + | homeostasis of brassinosteroids and cell cycling in rice. Plant J. 2012 |
| | + | May;70(3):398-408. doi: 10.1111/j.1365-313X.2011.04877.x. Epub 2012 Jan 24. |
| | + | Erratum in: Plant J. 2012 Aug;71(3):527. PubMed PMID: 22151303. |
| | + | </ref> |
| | + | </references> |
| | | | |
| − | ==References==
| |
| − | Please input cited references here.
| |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 4]] |
| − | GeneName = Os04g0576900|
| |
| − | Description = Protein kinase-like domain containing protein|
| |
| − | Version = NM_001060163.1 GI:115460055 GeneID:4336741|
| |
| − | Length = 2374 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os04g0576900, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
| |
| − | AP = Chromosome 4:29482652..29485025|
| |
| − | CDS = 29482653..29484521|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008397:29482652..29485025
| |
| − | source=RiceChromosome04
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008397:29482652..29485025
| |
| − | source=RiceChromosome04
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>ttgccacagctgcagtatgtgtcgctcgccggaaactctttctccggtgatgttccggaggggttcagcagcctgtggagtctgcgccacctcaacctctcggtgaactcattcacaggctcaatgccggctacctatggatacttgccatcactccaggtgctctcggcctcccacaaccgcatctgcggtgagctgcctgtggagctcgccaactgttccaacctcaccgtgcttgatctcaggagcaaccagttgactggcccaatccccggtgattttgcgcgcctcggcgaattggaggagcttgacctgagccacaaccagctgtcccgcaagatacctccagagatttcaaactgctcatcgcttgtcactctcaagcttgatgacaatcatcttggtggcgagataccggcctctctctccaacctgtcgaagctgcagacacttgacctgtcgtccaacaatcttaccggcagcatccctgcttcattggctcaaattccaggcatgctatcactcaatgtgtcacaaaatgagctcagcggagagataccggcaatgcttggctcccgctttggcaccccgtcagtgtttgcttccaacccgaacctgtgcggtccgccattggagaacgaatgcagtgcgtaccggcagcatcggaggcggcagaggctgcagcgcctcgctctgctgattggtgtggtggctgctaccgtgctgctgcttgtgctgttctgctgctgctgtgtgtacagcttgctgcggtggaggcgccggttcattgagaagcgagatggtgtcaagaagaggcggcgcagcccgggacggggcagcgggtcgagcggcacaagcacagacagtgtcagccagccgaagctgatcatgttcaattcccggatcacctatgctgacacggtggaggcgacgaggcagttcgatgaggagaatgtgcttagccgaggccgccatggtctcgtgttcaaggcttgctacaatgacggcaccgtgctggcgatcctacggcttccttccacctcatctgatggcgccgtggtgattgaggagggctcgttcaggaaggaggccgagtccctcggcaaggtgaagcacaggaacctcactgtgctccgtggctattacgccgggccgccgccagatgttcggctgctggtctatgactacatgcccaacggcaacctcgccacgttgctgcaggaagcgtcgcaccaagacggacacattctcaattggccaatgaggcacctgatcgccctcggcgtctcccgcggccttgcttttctccaccagtccggtgtcgtgcacggcgacgtcaagccgcagaacatcctcttcgatgccgacttcgagccgcacctgtccgacttcgggctggagccaatggtggtgacggctggtgctgccgctgctgcggcggctgcatcgacgtcagctacaacaacagtcggttcgctcggctacgtcgccccggacgccgcggccgcgggtcaggccacgcgggaaggcgacgtctacagcttcggcatcgtgctgctcgagctgctcaccggccggcgccccggcatgttcgccggggaggacgaagacatcgtgaagtgggtgaagcgtcagctgcagcgcggggcggtggccgagctgctcgagccgggcctgctggagctggacccggagtcgtcggagtgggaggagttcctgctcgggatcaaggtcggcctcctctgcacggcgcccgacccgctggaccgcccggccatgggcgacgtggtgttcatgctcgagggctgccgcgtcggcccggacatcccgtcgtcggccgacccaacctcccagccatccccggcgtga</cdnaseq>|
| |
| − | AA = <aaseq>LPQLQYVSLAGNSFSGDVPEGFSSLWSLRHLNLSVNSFTGSMPA TYGYLPSLQVLSASHNRICGELPVELANCSNLTVLDLRSNQLTGPIPGDFARLGELEE LDLSHNQLSRKIPPEISNCSSLVTLKLDDNHLGGEIPASLSNLSKLQTLDLSSNNLTG SIPASLAQIPGMLSLNVSQNELSGEIPAMLGSRFGTPSVFASNPNLCGPPLENECSAY RQHRRRQRLQRLALLIGVVAATVLLLVLFCCCCVYSLLRWRRRFIEKRDGVKKRRRSP GRGSGSSGTSTDSVSQPKLIMFNSRITYADTVEATRQFDEENVLSRGRHGLVFKACYN DGTVLAILRLPSTSSDGAVVIEEGSFRKEAESLGKVKHRNLTVLRGYYAGPPPDVRLL VYDYMPNGNLATLLQEASHQDGHILNWPMRHLIALGVSRGLAFLHQSGVVHGDVKPQN ILFDADFEPHLSDFGLEPMVVTAGAAAAAAAASTSATTTVGSLGYVAPDAAAAGQATR EGDVYSFGIVLLELLTGRRPGMFAGEDEDIVKWVKRQLQRGAVAELLEPGLLELDPES SEWEEFLLGIKVGLLCTAPDPLDRPAMGDVVFMLEGCRVGPDIPSSADPTSQPSPA</aaseq>|
| |
| − | DNA = <dnaseqindica>2..1870#tttgccacagctgcagtatgtgtcgctcgccggaaactctttctccggtgatgttccggaggggttcagcagcctgtggagtctgcgccacctcaacctctcggtgaactcattcacaggctcaatgccggctacctatggatacttgccatcactccaggtgctctcggcctcccacaaccgcatctgcggtgagctgcctgtggagctcgccaactgttccaacctcaccgtgcttgatctcaggagcaaccagttgactggcccaatccccggtgattttgcgcgcctcggcgaattggaggagcttgacctgagccacaaccagctgtcccgcaagatacctccagagatttcaaactgctcatcgcttgtcactctcaagcttgatgacaatcatcttggtggcgagataccggcctctctctccaacctgtcgaagctgcagacacttgacctgtcgtccaacaatcttaccggcagcatccctgcttcattggctcaaattccaggcatgctatcactcaatgtgtcacaaaatgagctcagcggagagataccggcaatgcttggctcccgctttggcaccccgtcagtgtttgcttccaacccgaacctgtgcggtccgccattggagaacgaatgcagtgcgtaccggcagcatcggaggcggcagaggctgcagcgcctcgctctgctgattggtgtggtggctgctaccgtgctgctgcttgtgctgttctgctgctgctgtgtgtacagcttgctgcggtggaggcgccggttcattgagaagcgagatggtgtcaagaagaggcggcgcagcccgggacggggcagcgggtcgagcggcacaagcacagacagtgtcagccagccgaagctgatcatgttcaattcccggatcacctatgctgacacggtggaggcgacgaggcagttcgatgaggagaatgtgcttagccgaggccgccatggtctcgtgttcaaggcttgctacaatgacggcaccgtgctggcgatcctacggcttccttccacctcatctgatggcgccgtggtgattgaggagggctcgttcaggaaggaggccgagtccctcggcaaggtgaagcacaggaacctcactgtgctccgtggctattacgccgggccgccgccagatgttcggctgctggtctatgactacatgcccaacggcaacctcgccacgttgctgcaggaagcgtcgcaccaagacggacacattctcaattggccaatgaggcacctgatcgccctcggcgtctcccgcggccttgcttttctccaccagtccggtgtcgtgcacggcgacgtcaagccgcagaacatcctcttcgatgccgacttcgagccgcacctgtccgacttcgggctggagccaatggtggtgacggctggtgctgccgctgctgcggcggctgcatcgacgtcagctacaacaacagtcggttcgctcggctacgtcgccccggacgccgcggccgcgggtcaggccacgcgggaaggcgacgtctacagcttcggcatcgtgctgctcgagctgctcaccggccggcgccccggcatgttcgccggggaggacgaagacatcgtgaagtgggtgaagcgtcagctgcagcgcggggcggtggccgagctgctcgagccgggcctgctggagctggacccggagtcgtcggagtgggaggagttcctgctcgggatcaaggtcggcctcctctgcacggcgcccgacccgctggaccgcccggccatgggcgacgtggtgttcatgctcgagggctgccgcgtcggcccggacatcccgtcgtcggccgacccaacctcccagccatccccggcgtgatcgccggctcccctcggccggcggcatcacccgatccagtccactagtgttgttccatccattttccgctaattctttcttctttagttcagattagtcttagcttcatccagccgcggggtcaaaactgacatgtgagcccgggagcaagaacacctgcatttcccgccaagcagaccagaggcttggccccaagtgggaaagtagccgttgagccccttcctaatctcgcggttagtggaggtgtcagtggctgccggggaagcaaatcaccatgtggactgatgcttgcgcggcatgttgcggaggaggaggttggtggtggtggcgtcgtggactcgcgcatgtggggttccccatcgcaacggctactgatgctccatctgttcttggctgctctgtaccctgtactcccttctctctctctctaggaaattgatttcgtgtaggggggcctgcttggcttcttcggatcttgtcttttattaatctccattttttacc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060163.1 RefSeq:Os04g0576900]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 4]]
| |
| − | [[Category:Chromosome 4]]
| |
