Difference between revisions of "Os04g0649100"

From RiceWiki
Jump to: navigation, search
(References)
 
(7 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os04g0649100''''' was reported as '''''SHAT1''''' in 2012 <ref name="ref1" /> by researchers from China and Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
===Function===
+
===Gene Symbol===
Please input function information here.
+
*'''''Os04g0459000''''' '''''<=>''''' '''''shat1,SHAT1,OsSHAT1'''''
  
The Expression of SHAT1 in AZ Is Positively Regulated bySH4。To exploit the effect ofSHAT1on AZ differentiation, we examinedSHAT1expression during early floral development using in situ hybridization. The inflorescence and spikelet developmental stages used in this study were according to the criteria reported before. Our analyses ofSHAT1gene expression in the wild type showed that when lemma and palea primordia were first visible on the flanks of the floral meristem at sp6 stage,SHAT1mRNA showed hotspots of expression in palea andlemma primordia .Subsequently,SHAT1signal declined in lemma and palea but appeared in the inner floral organ primordia, such as stamens and carpels during stage sp7, when carpel primordia began to differentiate . When the ovule was first visible,SHAT1 transcripts were restricted to the AZ and anthers from early stagesp8. Afterwards, during late sp8 stage, SHAT1 expression accumulated to higher levels in the AZ than during early stage sp8. We also characterized SHAT1 expression patterns in GLA4. Its genetic background is very close to the wild type, as mentioned above, but itssh4-1allele is the cultivated rice type. Therefore, we used GLA4 as the sh4-1 mutant line in this study. TheSHAT1signal in GLA4 was very similar to that in the wild type, showing converging expression in AZ from early stage sp8 and becoming more intense during late stage sp8. By contrast, the sh4-2mutation completely disruptedSHAT1expression in AZ, with no signals observed during stages sp6-sp8, similar to that in theshat1mutant.
+
* '''''OsSHAT1''''' gene  encodes an APETALA2 transcription factor.
 
+
* '''''OsSHAT1''''' is required for seed shattering through specifyingabscission zone (AZ) development in rice.
===Evolution===
+
===Expression===
Please input evolution information here.
+
* Genetic analyses revealed that the expression of '''''SHAT1''''' in AZ (Abscission Zone) was positively regulated by the trihelix transcription factor SH4. You can also add sub-section(s) at will.
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* National Center for Gene Research, National Center for Plant Gene Research (Shanghai) and Institute of Plant Physiology and
 +
Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai 200233, China
 +
* Plant Genome Center, Tsukuba, Ibaraki 305-0856, Japan
 +
* State Key Laboratory of Systematic and Evolutionary Botany, Key Laboratory of Plant Resources, Institute of Botany, Chinese Academy of Sciences, Beijing 100093, China
 +
* Zhejiang Academy of Agricultural Sciences, Hangzhou 310021, China
 +
* Beijing Institute of Genomics, Chinese Academy of Sciences, Beijing 100029, China
  
Zhou Y, Lu D, Li C, et al. Genetic control of seed shattering in rice by the APETALA2 transcription factor SHATTERING ABORTION1[J]. The Plant Cell Online, 2012, 24(3): 1034-1048.
+
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Zhou Y, Lu D, Li C, Luo J, Zhu BF, Zhu J, Shangguan Y, Wang Z, Sang T, Zhou B,
 +
Han B. Genetic control of seed shattering in rice by the APETALA2 transcription
 +
factor shattering abortion1. Plant Cell. 2012 Mar;24(3):1034-48. doi:
 +
10.1105/tpc.111.094383. Epub 2012 Mar 9. PubMed PMID: 22408071; PubMed Central
 +
PMCID: PMC3336138.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os04g0649100|
 
Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|
 
Version = NM_001187194.1 GI:297723518 GeneID:9269072|
 
Length = 2030 bp|
 
Definition = Oryza sativa Japonica Group Os04g0649100, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
 
AP = Chromosome 4:33471877..33473906|
 
CDS = 33471878..33472020,33472167..33472296|
 
GCID = <gbrowseImage1>
 
name=NC_008397:33471877..33473906
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008397:33471877..33473906
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>tatgtcctaatcgatcaccgtttcttcctctttcgttcgatcgttcgttcttgggcaatctcccgtaaatcatcttgtgggtttttggtgcactgcaggtacgtctacttggggctgttcgacaccgaggaggaagctgccagggcgtacgaccgcgctgccatcaagtgcaatggcaaggatgcggtgacgaacttcgatccaagcatttacgccggggagttcgagccgccgggtgggtgtgtcatgtgtgcgcttactgctcatggctag</cdnaseq>|
 
AA = <aaseq>YVLIDHRFFLFRSIVRSWAISRKSSCGFLVHCRYVYLGLFDTEE                    EAARAYDRAAIKCNGKDAVTNFDPSIYAGEFEPPGGCVMCALTAHG</aaseq>|
 
DNA = <dnaseqindica>2..144#291..420#gtatgtcctaatcgatcaccgtttcttcctctttcgttcgatcgttcgttcttgggcaatctcccgtaaatcatcttgtgggtttttggtgcactgcaggtacgtctacttggggctgttcgacaccgaggaggaagctgccaggtaaaattattgggccgcactgtgcgcgcgcgcggccattgttgttgaatgtcgagtgtggctgctgcgccgtttgcgagtttacgcttctgggttagatgggcgagcggtgatggtgattgatgtttcttgtctcttggccacagggcgtacgaccgcgctgccatcaagtgcaatggcaaggatgcggtgacgaacttcgatccaagcatttacgccggggagttcgagccgccgggtgggtgtgtcatgtgtgcgcttactgctcatggctaggctgttcgtttgtgagttgtgactgctcatccggacaaaatctgtcactgttttgcagcagcggccacgggtgatgccgccgagcacaacctggacctctcgcttgggagctcggcgggctccaagaggggcaacgttgacggtggcggggacgacgagatcaccggcggcggtggcggtggcgcgggctccgaccagcgcgtccctatggcgttcgaccttgactggcaaacggcggcggcgaggagcaccaaagctaaggtaaaaaaagaatggggactttgctttccgcatcagccgattgtcttctcatcacgtaataaaaaggcttaaaaattcctcgttttcttgtctagttcgaccagaactcgaaccatccccagatgcctccggtcctgcaggtcacccacctgccattcagtcccaggcatcatcaccaagtgggtagctcactatacaactccactccacttcgctccatttgctgctgaatttctcgcgtttggtttcaccggtatccgtgagctgatgaattcttgatgtctgtgctgctagttcttgagcaatggtgatccggggacagcgggaggcctgtcactgacgatcggcgcaggcatggccgggcactggcctccccagcagcagcaggggtggggcaacgccggcggcatgagctggccgcacccgccgcacccgccgccgccgccgaccaacgccgcggccgccgcaaccgctacagcagctgcagcatcatcacgattccctccctacattgcgacgcaagcctcaacctggctgcagaagaacgggttccattccctgacccggcccacctaagatgatcaaagatttaaaattcaagatcgctgcattcatcgtctcctcgtcgatcgatcatggcaaagatcgatggagagagagaggtgtgtgtcactgacgcagggaaaaactcaatgcagatttaccagcaagaacaagagctggatgctattcttttgctctaccttttttcttctctctttcttcttctctgtttcttgattgggcgagcgagatggagatggatctgatcatgaatgggacacaagtgggcatgtaaatgaggagctccctagaaggcgagagagattggccaagcgtcgcctcaagcagtgtaggagtatctatcttttgccgtttcgctcgctttctttccttcttttctttcaccatggccaacaacgatgactctgggtgtcaacatcacagctcattttgttcggtctcatgttgcatcattcactgcatgatgaccatgattcgggaaaatttgctccatgcacctccgcttggccgacaacacttgccctctagtaagcatccttaaacacccacggtttctactactattcatcgctttataaatcctacggagtgctagctttacgctactactactgtcatgtaatctatcatcatcaaaagagacgatcagattaacatatatgtcaactatttaagctttggctctttgctttccaagaaacgtaactgccgagatgtggagcatatagaagtattcgtccttctagatgttggtactaaagtaatgttctttcttttctccctct</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001187194.1 RefSeq:Os04g0649100]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 03:11, 22 October 2016

The rice Os04g0649100 was reported as SHAT1 in 2012 [1] by researchers from China and Japan.

Annotated Information

Gene Symbol

  • Os04g0459000 <=> shat1,SHAT1,OsSHAT1
  • OsSHAT1 gene encodes an APETALA2 transcription factor.
  • OsSHAT1 is required for seed shattering through specifyingabscission zone (AZ) development in rice.

Expression

  • Genetic analyses revealed that the expression of SHAT1 in AZ (Abscission Zone) was positively regulated by the trihelix transcription factor SH4. You can also add sub-section(s) at will.

Labs working on this gene

  • National Center for Gene Research, National Center for Plant Gene Research (Shanghai) and Institute of Plant Physiology and

Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai 200233, China

  • Plant Genome Center, Tsukuba, Ibaraki 305-0856, Japan
  • State Key Laboratory of Systematic and Evolutionary Botany, Key Laboratory of Plant Resources, Institute of Botany, Chinese Academy of Sciences, Beijing 100093, China
  • Zhejiang Academy of Agricultural Sciences, Hangzhou 310021, China
  • Beijing Institute of Genomics, Chinese Academy of Sciences, Beijing 100029, China

References

  1. Zhou Y, Lu D, Li C, Luo J, Zhu BF, Zhu J, Shangguan Y, Wang Z, Sang T, Zhou B, Han B. Genetic control of seed shattering in rice by the APETALA2 transcription factor shattering abortion1. Plant Cell. 2012 Mar;24(3):1034-48. doi: 10.1105/tpc.111.094383. Epub 2012 Mar 9. PubMed PMID: 22408071; PubMed Central PMCID: PMC3336138.

Structured Information