|
|
| (4 intermediate revisions by 2 users not shown) |
| Line 2: |
Line 2: |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | [[File:162-Os04g0674700.png|right|thumb|227px|'''Figure 5.''' ''Stomatal densities on the adaxial and abaxial surfaces of flag leaves of wild-type (WT) and slac1 mutant plants grown under 350 ppm or 700 ppm [CO 2 ].<ref name="ref1" />.'']] |
| | + | |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| + | * '''''SLAC1''''' is a stomatal anion channel protein controlling stomatal closure in response to environmental CO2. |
| | + | * '''''SLAC1''''' function is conserved between Arabidopsis and rice |
| | + | ===Phenotypic analysis=== |
| | | | |
| − | ===Expression===
| + | * The '''''slac1''''' mutation caused an increase in stomatal conductance concomitant with lowered leaf temperatures, but did not affect other observable morphological phenotypes of the mutant plants. |
| − | Please input expression information here.
| + | * For example, stomatal density is a representative stomatal phenotype and is known to respond to various environmental factors, such as elevated [CO2] and drought stress, but stomatal density was not affected in the '''''slac1''''' mutant (Fig. 5). |
| − | | |
| − | ===Evolution===
| |
| − | Please input evolution information here.
| |
| | | | |
| | You can also add sub-section(s) at will. | | You can also add sub-section(s) at will. |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | * Department of Biology, Faculty of Science, Kyushu University, Fukuoka 812–8581, Japan |
| | + | * Faculty of Agriculture, Kyushu University, Fukuoka 812–8151, Japan |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | <references> |
| | + | * <ref name="ref1"> |
| | + | Xu Y, Zhang S, Guo H, Wang S, Xu L, Li C, Qian Q, Chen F, Geisler M, Qi Y, |
| | + | Jiang de A. OsABCB14 functions in auxin transport and iron homeostasis in rice |
| | + | (Oryza sativa L.). Plant J. 2014 Jul;79(1):106-17. doi: 10.1111/tpj.12544. Epub |
| | + | 2014 Jun 13. PubMed PMID: 24798203. |
| | + | </ref> |
| | + | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 4]] |
| − | GeneName = Os04g0674700|
| |
| − | Description = Similar to AMP-binding protein (Adenosine monophosphate binding protein 5 AMPBP5)|
| |
| − | Version = NM_001060777.1 GI:115461283 GeneID:4337383|
| |
| − | Length = 1983 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os04g0674700, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
| |
| − | AP = Chromosome 4:34844701..34846683|
| |
| − | CDS = 34844827..34846302,34846389..34846589|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008397:34844701..34846683
| |
| − | source=RiceChromosome04
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008397:34844701..34846683
| |
| − | source=RiceChromosome04
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggacaagctcggcgccaacccggccaactcgtgcgcgctcacgccgctgggcttcctggagcgcgccgccaccgtgttcggcgactgcccgtccgtcgtctaccacgacaccgtcttcacgtggtcgcagacccaccgccgctgcctccgcctcgcctccgcgctcgtctcctccctcggcatctcccgcggcgacgtcgtgtccgtgctcctgccgaacgtgccggcgatgtacgagatgcacttcgccgtgccgatgagcggcgccgtgctgaacagcatcaacacgcggctcgacgcgcgcacggtgtccgtcctgctccgccactccggctccaagctcatcttcgtcgacccggcgctgctccccgtcctccgcgacgcgctccgcctcctcccggcggggcacacggccccgcgcgtcgtcctcgtcgaggatccccatgagaaggagttccctcccgcccccgccgccgcgctgacgtacgagaggctcgtcgagaagggggacccggagttcgcgtgggtgcggccggcgagcgagtgggacccgatgatcctcaactacacctccggcaccacgtcggcgcccaagggggtggtgcactgccaccgggggatcttcctcatcaccgtcgactcgctggtcgactgggcggtgccgccgcggccgacgtacctgtggacgctccccatgttccacgccaatggctggagcttcccatgggggatggccgtggtgggcggcaccaacgtctgcctccgccgcgtcgacgccgccgaggtgttcgacacaatcgcgcgccgcggcgtcaaccacctgtgcggcgcgcccgtcgtgctcaacatgctggcgaacgcgcccgagggcgtgcggaagccgctcccggggaaggtgcggatcctcacggccggcgcgccgccgccggccgccgtgctgtaccgcacggaggcgatcggcttcgaggtcagccacgggtacgggctgacggagaccgcgggtctggtgctctcgtgcgcgtggaagggcgagtgggacaagctcccggcctccgagcgcgcgcggctcaaggcgaggcagggcgtgcgcacgccggggatggccgaggtggacgtcgtggacggcgagaccggccgcagcgtgccccgcgacgggtcgaccatgggcgagatcgtgctccgcggcggctgcatcacgctgggctacctcaacgacgaggcggcgacgaaggcggcgatccgggacaacgggtggttctacaccggcgacgtcggggtgatgcacccggacgggtacgtggagatccgggaccggtccaaggacgtgatcatcagcggcggggagaacatcagcagcgtggaggtggagtccgtgctgtacggccacccggcggtgaacgaggcggcggtggtggcgcggccggacgagttctggggggagacgccgtgcgcgttcgtcagcctcaagcagggcggcggcgcggtgacggcggcggacgtggtcgcgtggagccgggagcgcatgccgcggtacatggtcccaaagacggtgatcttccgcgacgagttaccgaagacgtccaccgggaagatccagaagtacgtgctccggaatatcgccaaggagatggggcccaccacgggcaccaacaccaaacgcaacagtaaaatgtag</cdnaseq>|
| |
| − | AA = <aaseq>MDKLGANPANSCALTPLGFLERAATVFGDCPSVVYHDTVFTWSQ THRRCLRLASALVSSLGISRGDVVSVLLPNVPAMYEMHFAVPMSGAVLNSINTRLDAR TVSVLLRHSGSKLIFVDPALLPVLRDALRLLPAGHTAPRVVLVEDPHEKEFPPAPAAA LTYERLVEKGDPEFAWVRPASEWDPMILNYTSGTTSAPKGVVHCHRGIFLITVDSLVD WAVPPRPTYLWTLPMFHANGWSFPWGMAVVGGTNVCLRRVDAAEVFDTIARRGVNHLC GAPVVLNMLANAPEGVRKPLPGKVRILTAGAPPPAAVLYRTEAIGFEVSHGYGLTETA GLVLSCAWKGEWDKLPASERARLKARQGVRTPGMAEVDVVDGETGRSVPRDGSTMGEI VLRGGCITLGYLNDEAATKAAIRDNGWFYTGDVGVMHPDGYVEIRDRSKDVIISGGEN ISSVEVESVLYGHPAVNEAAVVARPDEFWGETPCAFVSLKQGGGAVTAADVVAWSRER MPRYMVPKTVIFRDELPKTSTGKIQKYVLRNIAKEMGPTTGTNTKRNSKM</aaseq>|
| |
| − | DNA = <dnaseqindica>382..1857#95..295#tttcctcgcctccactccaaccaccccgcgatagctggagtcaccggcgttcacacaggcgacagctcgtgctccggcgatcgacgcggcggccatggacaagctcggcgccaacccggccaactcgtgcgcgctcacgccgctgggcttcctggagcgcgccgccaccgtgttcggcgactgcccgtccgtcgtctaccacgacaccgtcttcacgtggtcgcagacccaccgccgctgcctccgcctcgcctccgcgctcgtctcctccctcggcatctcccgcggcgacgtcgtgagcatccatcgatcctttttccttccacggtcatttcgtcgaacaccttcctcgtgttgctaagctaagctggattgagtcaggtgtccgtgctcctgccgaacgtgccggcgatgtacgagatgcacttcgccgtgccgatgagcggcgccgtgctgaacagcatcaacacgcggctcgacgcgcgcacggtgtccgtcctgctccgccactccggctccaagctcatcttcgtcgacccggcgctgctccccgtcctccgcgacgcgctccgcctcctcccggcggggcacacggccccgcgcgtcgtcctcgtcgaggatccccatgagaaggagttccctcccgcccccgccgccgcgctgacgtacgagaggctcgtcgagaagggggacccggagttcgcgtgggtgcggccggcgagcgagtgggacccgatgatcctcaactacacctccggcaccacgtcggcgcccaagggggtggtgcactgccaccgggggatcttcctcatcaccgtcgactcgctggtcgactgggcggtgccgccgcggccgacgtacctgtggacgctccccatgttccacgccaatggctggagcttcccatgggggatggccgtggtgggcggcaccaacgtctgcctccgccgcgtcgacgccgccgaggtgttcgacacaatcgcgcgccgcggcgtcaaccacctgtgcggcgcgcccgtcgtgctcaacatgctggcgaacgcgcccgagggcgtgcggaagccgctcccggggaaggtgcggatcctcacggccggcgcgccgccgccggccgccgtgctgtaccgcacggaggcgatcggcttcgaggtcagccacgggtacgggctgacggagaccgcgggtctggtgctctcgtgcgcgtggaagggcgagtgggacaagctcccggcctccgagcgcgcgcggctcaaggcgaggcagggcgtgcgcacgccggggatggccgaggtggacgtcgtggacggcgagaccggccgcagcgtgccccgcgacgggtcgaccatgggcgagatcgtgctccgcggcggctgcatcacgctgggctacctcaacgacgaggcggcgacgaaggcggcgatccgggacaacgggtggttctacaccggcgacgtcggggtgatgcacccggacgggtacgtggagatccgggaccggtccaaggacgtgatcatcagcggcggggagaacatcagcagcgtggaggtggagtccgtgctgtacggccacccggcggtgaacgaggcggcggtggtggcgcggccggacgagttctggggggagacgccgtgcgcgttcgtcagcctcaagcagggcggcggcgcggtgacggcggcggacgtggtcgcgtggagccgggagcgcatgccgcggtacatggtcccaaagacggtgatcttccgcgacgagttaccgaagacgtccaccgggaagatccagaagtacgtgctccggaatatcgccaaggagatggggcccaccacgggcaccaacaccaaacgcaacagtaaaatgtagcggcatctagccagcagatgtggcacttgctttttagcgtcgtcgtcgtcttcttcactcggacagagtcacagagcagaaatgtctggtgcaggcagaggctgatgcattccgcattgtcatggc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060777.1 RefSeq:Os04g0674700]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 4]]
| |
| − | [[Category:Chromosome 4]]
| |
