|
|
| (3 intermediate revisions by 2 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os06g0142600''''' was reported as '''''Hd17''''' in 2014 <ref name="ref1" /> by researchers from China. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os06g0142600''''' '''''<=>''''' '''''Hd17, EF7, Ef7, OsELF3-1, OsELF3''''' |
| | ===Function=== | | ===Function=== |
| − | Heading date 17 (Hd17) is a gene that encodes a homolog of Arabidopsis EARLY FLOWERING 3 (ELF3),which plays important roles in maintaining circadian rhythms, and that the QTL lies within the pathway responsible for rice’s | + | * Heading date 17 (Hd17) is a gene that encodes a homolog of Arabidopsis EARLY FLOWERING 3 (ELF3),which plays important roles in maintaining circadian rhythms, and that the QTL lies within the pathway responsible for rice’s photoperiodic flowering through the modulation of the transcription level of a flowering repressor, Grain number, plant height and heading date7(Ghd7). |
| − | photoperiodic flowering through the modulation of the transcription level of a flowering repressor, Grain number, plant height and heading date7(Ghd7). Natural variation in Hd17 may change the transcription level of a flowering repressor, Grain number, plant height and heading date 7 (Ghd7), suggesting that Hd17 is part of rice’s photoperiodic flowering pathway<ref name="ref1" />.The QTL mapped on chromosome 6 was designated as Hd17. Both Hd16and Hd17 are involved in photoperiod response, as revealed by observation of heading date in near-isogenic lines (NILs) under SD and LD conditions<ref name="ref3" />. | + | * Natural variation in Hd17 may change the transcription level of a flowering repressor, Grain number, plant height and heading date 7 (Ghd7), suggesting that Hd17 is part of rice’s photoperiodic flowering pathway<ref name="ref1" />. |
| − | | |
| − | ===Expression===
| |
| − | Os06g1042600 is the Hd17 gene, and that the SNP in Os06g0142600 caused the flowering time difference between
| |
| − | ‘Nipponbare’ and NIL-Hd17. Nevertheless, the nucleotide change in Hd17 does not appear to affect its transcription level.The nucleotide change in Hd17 did not seem to affect Hd1 expression; however, its effect on flowering time disappeared in a background with a defective Hd1 allele[1].Hd17 promotes flowering under long and short day conditions by negatively regulating the flowering repressor Ghd7, and consequently upregulating levels of Ehd1 and FT-like gene expression<ref name="ref2" />.
| |
| − | | |
| − | ===Evolution===
| |
| − | Genes which have been isolated as key regulators of the photoperiodic regulation of flowering are well conserved between rice and Arabidopsis<ref name="ref4" />.Natural variation in heading date and photoperiod sensitivity has played pivotal roles in a wide range of regional adaptations in many crop plants<ref name="ref5" />.
| |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | 1.National Institute of Crop Science, Tsukuba, Ibaraki, 305-8518 Japan.
| + | * National Institute of Agrobiological Sciences, Tsukuba, Ibaraki, 305-8634 Japan |
| − | | + | * Present address: National Institute of Crop Science, Tsukuba, Ibaraki, 305-8518 Japan |
| − | 2.Institute of Crop Science, National Agriculture and Food Research Organization, Tsukuba, Ibaraki, 305-8518 Japan.
| |
| − | | |
| − | 3.National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan.
| |
| − | | |
| − | 4.Chinese National Center for Rice Improvement / State Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou 310006, China.
| |
| − | | |
| − | 5.Department of Plant Science, Plant Genomics and Breeding Institute, and Research Institute for Agriculture and Life Sciences,
| |
| − | Seoul National University, Seoul 151-921, Republic of Korea.
| |
| − | | |
| − | 6.Key Lab of Crop Heterosis and Utilization of Ministry of Education, and Beijing Key Lab of Crop Genetic Improvement, China Agriculture University, Beijing 100093, China.
| |
| − | | |
| − | 7.Institute of Green Bio Science and Technology, Seoul National University, Pyeongchang 232-916, Republic of Korea.
| |
| | | | |
| | ==References== | | ==References== |
| | <references> | | <references> |
| − | <ref name="ref1"> | + | * <ref name="ref1"> |
| − | Costa, L. M. From Biological Warfare to the Brighter Side of Rice Research. Plant Cell Physiol 53, no. 4 (2012): 603-5.</ref>
| + | Matsubara K, Ogiso-Tanaka E, Hori K, Ebana K, Ando T, Yano M. Natural |
| − | <ref name="ref2">
| + | variation in Hd17, a homolog of Arabidopsis ELF3 that is involved in rice |
| − | Matsubara, K., E. Ogiso-Tanaka, K. Hori, K. Ebana, T. Ando and M. Yano. Natural Variation in Hd17, a Homolog of Arabidopsis Elf3 That Is Involved in Rice Photoperiodic Flowering. Plant and Cell Physiology 53, no. 4 (2012): 709-716.</ref> | + | photoperiodic flowering. Plant Cell Physiol. 2012 Apr;53(4):709-16. doi: |
| − | <ref name="ref3">
| + | 10.1093/pcp/pcs028. Epub 2012 Mar 6. PubMed PMID: 22399582. |
| − | Kazuki M, Kiyosumi H, Eri O T, Masahiro Y. Cloning of quantitative trait genes from rice reveals conservation and divergence of photoperiod flowering pathways in Arabidopsis and rice. (2014).</ref>
| + | </ref> |
| − | <ref name="ref4">
| |
| − | Guo, Liang, Zhen-hua Zhang and Jie-yun Zhuang. "Quantitative Trait Loci for Heading Date and Their Relationship with Genetic Control of Yield Traits in Rice (Oryza Sativa)." Rice Science 20, no. 1 (2013): 1-12.</ref>
| |
| − | <ref name="ref5">
| |
| − | Kwon, C. T., S. C. Yoo, B. H. Koo, S. H. Cho, J. W. Park, Z. Zhang, J. Li, Z. Li and N. C. Paek. "Natural Variation in Early Flowering1 Contributes to Early Flowering in Japonica Rice under Long Days." Plant Cell Environ 37, no. 1 (2014): 101-12.</ref>
| |
| | </references> | | </references> |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os06g0142600|
| |
| − | Description = Conserved hypothetical protein|
| |
| − | Version = NM_001063305.2 GI:297605157 GeneID:4340087|
| |
| − | Length = 5003 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os06g0142600, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
| |
| − | AP = Chromosome 6:2233133..2238135|
| |
| − | CDS = 2235411..2236400,2237799..2238059|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008399:2233133..2238135
| |
| − | source=RiceChromosome06
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008399:2233133..2238135
| |
| − | source=RiceChromosome06
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggcgacgaggggaggaggcggaggaggaggagggaaggaggcgaaggggaaggtgatgggcccgctgttcccgcggctccacgtcaacgacgcggccaagggcggaggcccgcgggcgccgccccggaacaagatggcgctctacgagcagttcaccgtgccctcgcatcgcttcagcggcggaggaggcggcggcggagtaggaggcagccccgcgcactcgacgtcggcggcgagccagagccagagccagagccaggtttatggacgtgacagttctctgttccagccgttcaatgtgccttccaatcgacctggccattctactgaaaagatcaattcagataagatcaacaagaagattagtggttcaagaaaagaactggggatgttatcctctcagactaagggcatggatatttatgcttcaagatcaactgctgaggcaccacaaagaagagcagaaaatacaataaagagttcttcgggaaagagattggccgatgatgatgaatttatggttccttctgtcttcaattccagatttcctcaatatagtactcaagagaatgcaggggttcaagaccaatcaacaccccttgttgctgcaaatccacacaaaagcccttcaacagtgtccaaatcatccacaaagtgttataacactgttagcaagaaattggagagaatccatgtttctgatgtgaaatcaaggacccctttgaaagacaaggagatggaagcagcacagacatccaaaaacgtggaagttgaaaaaagttcatcctttcatgcttccaaagatatgtttgaaagcaggcatgctaaagtatatcctaagatggataagacgggcattataaatgattctgatgagccacatggtggaaatagtgggcatcaagcgacaagcagaaatggaggttccatgaaatttcagaaccctccaatgagaagaaatgaaatttcctctaatccatcttctgaaaatactgataggcattataatttaccgcaaggaggcatagaggaaacaggtacaaagagaaaaaggttgctagaacaacacgatgcagagaaaagtgatgatgtgtcaaggttgctagaacaacacgatgcagagaacattgatgatgtgtctgattcctcggtggagtgtataactggttgggagatttctccagataaaattgttggagccattggtacaaagcatttctggaaagcaagacgtgctattatgaagtaa</cdnaseq>|
| |
| − | AA = <aaseq>MATRGGGGGGGGKEAKGKVMGPLFPRLHVNDAAKGGGPRAPPRN KMALYEQFTVPSHRFSGGGGGGGVGGSPAHSTSAASQSQSQSQVYGRDSSLFQPFNVP SNRPGHSTEKINSDKINKKISGSRKELGMLSSQTKGMDIYASRSTAEAPQRRAENTIK SSSGKRLADDDEFMVPSVFNSRFPQYSTQENAGVQDQSTPLVAANPHKSPSTVSKSST KCYNTVSKKLERIHVSDVKSRTPLKDKEMEAAQTSKNVEVEKSSSFHASKDMFESRHA KVYPKMDKTGIINDSDEPHGGNSGHQATSRNGGSMKFQNPPMRRNEISSNPSSENTDR HYNLPQGGIEETGTKRKRLLEQHDAEKSDDVSRLLEQHDAENIDDVSDSSVECITGWE ISPDKIVGAIGTKHFWKARRAIMK</aaseq>|
| |
| − | DNA = <dnaseqindica>1736..2725#77..337#atggccacaaaaaccggcgacctcctccaccccgccatggcctgacgcccccgagaagctgctgcggcgggaggcgatggcgacgaggggaggaggcggaggaggaggagggaaggaggcgaaggggaaggtgatgggcccgctgttcccgcggctccacgtcaacgacgcggccaagggcggaggcccgcgggcgccgccccggaacaagatggcgctctacgagcagttcaccgtgccctcgcatcgcttcagcggcggaggaggcggcggcggagtaggaggcagccccgcgcactcgacgtcggcggcgagccagagccagagccagagccaggtgactcgacgtcctgcccgtatgatcgattcgattgggggtagtgtgtgcgactgctaaattggtactagtaggcgacaattctgtgcaaatggagctaaacgccttgcaaatcgaatcgaattagaagcctaaattggtaggcaataattctgtgcaatggagctaaacttccttgcaaatcgaatagaactaaaagctgggaagataatttcgaggcacaaatggtgccctcgacgtcgacgagctaggtcagagggggcgtttcacgccttaccctttgtagttatctcggttgggatagatgaattgatgggcgaatttagtgcaacggagctaaacacatggaaaaattggataagattaaggccgagaagcccagtttgaggcacaaatgccatgttccttttgtgctgattaatctatcatgccgtcgacatgtgattcaattacttgcaaatatagtcatacaattgtggtaggagtaacatgcttgcacgttgtcatagtgtcattattgatctttctccgtgctgataactcacttgtgttgaaggcgaaagagcagaacaaaaccattatatgcagtttacatcagctcttccggtaaagttttggagacggggcataagttccttgcaaacaatatcggatattatagcttattgcaaattgtatatggccagatatgctatgattgtgtttgctgaggtctggtgtttgtaatatacaaacaaaaaggtccacatgtgaaactgcatgtagcgcaggtggcaaagagtagccgtagtgctgctcaacgtactgtgttctattctccctgacgtgctcaccttccttaaatcattgacactaggttcctccttagtgtcttgcatttttgcctgccgaaaaaaaaaggtccacgtgaaagggaatgataaaaatggtggttgatatgctttgattgtcaggcacacgttcaacctgtatgtgataaatatcaacggttttctaatactgttttcagcaaggatttaggagtggaaaatattctttagaacaaatctgcaatagcctcccacaacacatccaactaccttttgataatgggatagttatagacatgaagtgcgaatggcaaaagtccaagtcatagatttccaaatgaagaaatgtgaacaaaataagaaagaaagaagtccatttgcagtattatgtctcttttgcccttctttgggtcgaaaataaaataaaaaatcgagatcttaccatgagatacttaatctcccaccactttttctaattcaacatggaagttcttggatagtttaaatacgcttcctaccaattagcgtggaatcctcgcaatttttcactaaatctagtagtactgaaatggattttattttcttccaggtttatggacgtgacagttctctgttccagccgttcaatgtgccttccaatcgacctggccattctactgaaaagatcaattcagataagatcaacaagaagattagtggttcaagaaaagaactggggatgttatcctctcagactaagggcatggatatttatgcttcaagatcaactgctgaggcaccacaaagaagagcagaaaatacaataaagagttcttcgggaaagagattggccgatgatgatgaatttatggttccttctgtcttcaattccagatttcctcaatatagtactcaagagaatgcaggggttcaagaccaatcaacaccccttgttgctgcaaatccacacaaaagcccttcaacagtgtccaaatcatccacaaagtgttataacactgttagcaagaaattggagagaatccatgtttctgatgtgaaatcaaggacccctttgaaagacaaggagatggaagcagcacagacatccaaaaacgtggaagttgaaaaaagttcatcctttcatgcttccaaagatatgtttgaaagcaggcatgctaaagtatatcctaagatggataagacgggcattataaatgattctgatgagccacatggtggaaatagtgggcatcaagcgacaagcagaaatggaggttccatgaaatttcagaaccctccaatgagaagaaatgaaatttcctctaatccatcttctgaaaatactgataggcattataatttaccgcaaggaggcatagaggaaacaggtacaaagagaaaaaggttgctagaacaacacgatgcagagaaaagtgatgatgtgtcaaggttgctagaacaacacgatgcagagaacattgatgatgtgtctgattcctcggtggagtgtataactggttgggagatttctccagataaaattgttggagccattggtacaaagcatttctggaaagcaagacgtgctattatgaagtaagtaaaactatccttttgagcttagtttggcccactcaaactagacttgtttgcagctctaattacgtataggtagctttgatgaataaaatttgttttgtttcccttgctttactgttatttgctcttaatttgcggttgatcttaatcatcttagacagaaaaacatgatgactatctcgtttgtttttggtttatttcatatttgaatgccaatagatgtcagctccagatgatatttcaaatacctcatgcatggaaactgtgcatacttatgccaaattttgggcttacaagtcagcatgtctacaaatttctttggcagaattaatatatatctagttcaacatttgctgatttgtaattggattagttgtctgcagaatgccggcatgttttattttcctttcaactaggtcaatcagttttgttgttgtctgttgttcttgtccacctacacctgtactactgaaatgttctcttttggagatgtcaatgaaaattttaatctatagtggtttcaattttattttcattttagtcaagaagaatggcataatctcatttaaaaagattgtaaaagtgtccctgttaaagtgatattgtaggtattgctttaccaagctactgtatgattccctttattgttttacactctaatcttctttaaactctatgcagtcaacagagggtgtttgctgtccaggtttttgagctgcataagttggtaaaagtgagtctagcaaatttctcttccttctagccactcttaagcaggttaattcgtggataggattttgtccataatctgtttataacccacacttgtatttgacttacaatcaggtgcagaagttgattgcagcatcgccacatgtacttattgaaagtgatccttgccttggcaatgccttgttgggtagcaagaacaagctggtggaagaaaacctgaaagcacaacctcttttagtcgcaaccatcgatgacgtggagccaagtctacagcaaccggaggtatcaaaagaaaacactgaagacagcccaccctcccctcatgatactgggcttggcagtggtcaacgtgatcaagctgcaacaaatggcgtctctaaaagcaatcgtcgagctacacctgttgcttctgataacaaacaaaataactggggcgttcaacttcaaccacctcaaaatcaatggcttgtccctgtcatgtctcctttggaaggccttgtctataagccttattctggtccgtgccctccagctggtagcatattggccccgttttatgccaactgtactcctttgagtcttccatcaacagctggagatttcatgaactcggcatacggtgttcctatgcctcatcagccacaacatatgggtgctcctggccctccttccatgcctatgaactacttcccgcctttcagcataccagtgatgaacccaactgcaccggcacctgtagtcgaacaagggagacatccttcgatgccacagccttatgggaactttgagcagcagtcgtggatctcatgtaacatgtcacatccaagtggcatttggagatttcatgcctcaagagatagcgaggcacaggccagcagcgctagcagtccttttgacaggttccaatgcagtggaagtggtcctgtatccgccttccccacagtatcagctcagaacaaccagcctcagccctcatatagcagccgggacaaccagaccaatgttatcaaggttgttccacataattcacgaactgcttcagagtcagcagcacggattttccggtcaatacaaatggaacggcaacgagatgattgatagccatgagaactggcaattttatgctggatgcatttgatgacttggtaaatgtagagaagaggtttgccagattatggtgacccctatatttatcctgaccgtttatagacagatgatgatactgtatattctcaagggcgggctccgtcagggtgatgtcgccccttcgtcaatttgtaatgtattttgtacagtaggacaggacagtatctgtttaactttaacgctatgtaaagccattgctggtcagttaagcagaataatactaaagctaatgagctggggaaaagaccccgctctttttatctctttcttttgtgaaccctgattacgagttaaggccccgcgccatttgtggggatttgctcttataagtgtgtgatctatattgcaaacagaatggagatatatgatttttggatatatgtaatgtgtgccagtatttt</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063305.2 RefSeq:Os06g0142600]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |