Difference between revisions of "Os03g0669100"

From RiceWiki
Jump to: navigation, search
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''Os03g0669100''' was reported as '''RGB1''' in 2005 <ref name="ref1" /> by researchers from the USA.  
 
+
<br>
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''Os03g0669100 <=> RGB1'''
 +
<br>
 +
===Cooperate Gene===
 +
*'''RGA1'''
 
===Function===
 
===Function===
Please input function information here.
+
*Gbc and Ga cooperatively function in cellular proliferation and seed fertility
 
+
<br>
===Expression===
+
===Mutation===
Please input expression information here.
+
*RGB1 knock-down lines were generated in the wild type and d1-5, a mutant deficient for the heterotrimeric G protein a-subunit (Ga) gene (RGA1). Both transgenic lines showed browning of the lamina joint regions and nodes that could be attributed to a reduction of RGB1 function, as the abnormality was not observed in d1-5. The RGB1 knock-down lines generated in d1-5 were shorter, suggesting RGB1 to be a positive regulator of cellular proliferation, in addition to RGA1. The number of sterile seeds also increased in both RGB1 knock-down lines.  
 
+
<br>
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
 
 
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Department of Bioscience, Fukui Prefectural University, 4-1-1 Matsuoka Kenjyojima, Eiheiji-cho, Yoshida-gun,Fukui 910-1195, Japan
 
+
<br>
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
<ref name="ref1">
 +
Characterization of a histidine- and alanine-rich protein showing interaction with calreticulin in rice
 +
</ref>
  
 +
</references>
 +
<br>
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 3]]
GeneName = Os03g0669100|
 
Description = Similar to Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23) (dUTPase) (dUTP pyrophosphatase) (P18)|
 
Version = NM_001057397.1 GI:115454522 GeneID:4333679|
 
Length = 988 bp|
 
Definition = Oryza sativa Japonica Group Os03g0669100, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:27156814..27157801|
 
CDS = 27156939..27157001,27157058..27157266,27157354..27157445,27157543..27157721|
 
GCID = <gbrowseImage1>
 
name=NC_008396:27156814..27157801
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:27156814..27157801
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggccaccgctaccaacggcaacgcctccgccgccgccgccgccgctgactccgccgtccaggagcccccgcacaagatcgccaaggttgctcccttgctcaaggtcaagaagctctccgagaacgccgtcctgccgtcccgcggctccgccctcgccgccggctacgacctgtcgagcgcggcggaggtcgtcgtgccggcgagggggaaggcgatggtgccgacggacctcagcatcgccatcccggagggcacctacgcgcgcgtcgcgccgaggtctgggctggcgttgaagcactcgatcgacgtaggcgccggggtgatcgacgccgactaccgtggcccggtaggggtcatcctcttcaaccactccgacaccgacttcgccgtgaagcccggcgaccggatcgcgcagatgatcatcgaggtgatcgtgacgccggaggtcgccgaggtggaggacctcgacgccaccgtcgttagctccaggaagttgggggagttcatttggtctgtgatggatggatgggtgatgtcgtga</cdnaseq>|
 
AA = <aaseq>MATATNGNASAAAAAADSAVQEPPHKIAKVAPLLKVKKLSENAV                    LPSRGSALAAGYDLSSAAEVVVPARGKAMVPTDLSIAIPEGTYARVAPRSGLALKHSI                    DVGAGVIDADYRGPVGVILFNHSDTDFAVKPGDRIAQMIIEVIVTPEVAEVEDLDATV                    VSSRKLGEFIWSVMDGWVMS</aaseq>|
 
DNA = <dnaseqindica>801..863#536..744#357..448#81..259#aaatccactcacctcctccaccgttcgtccccttctcgcgccaccaccgcctgccgccgagagctctctcagccgtcgccatggccaccgctaccaacggcaacgcctccgccgccgccgccgccgctgactccgccgtccaggagcccccgcacaagatcgccaaggttgctcccttgctcaaggtcaagaagctctccgagaacgccgtcctgccgtcccgcggctccgccctcgccgccggctacgacctgtcgaggtacgcgcccggcaaggtctccccgtgaaaaacaaaaatggcatcgccgttggtggttgtttacaccgtttttgtgggtttttttttctgatctcagcgcggcggaggtcgtcgtgccggcgagggggaaggcgatggtgccgacggacctcagcatcgccatcccggagggcacctacgcgcgcgtcggtgagcatttcctctctttattcttttccgtccattcctttcttgcttgcgcaccaggtgtttgacgaaatgcctgtccggttttagcgccgaggtctgggctggcgttgaagcactcgatcgacgtaggcgccggggtgatcgacgccgactaccgtggcccggtaggggtcatcctcttcaaccactccgacaccgacttcgccgtgaagcccggcgaccggatcgcgcagatgatcatcgaggtgatcgtgacgccggaggtcgccgaggtggaggacctcgacgccaccgtcaggggagagggagggttcggatccaccggcgtctgaatgaatgaagcatcgtcgtcgttagctccaggaagttgggggagttcatttggtctgtgatggatggatgggtgatgtcgtgatgaaacacttgtatcctcttaatgcctcggatgcttttgtggtgtcgaatggaatcatctagcctaatgaatctaatgaaattcgtatgcttttgcggtgttgaatggaataatctagtctaatg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057397.1 RefSeq:Os03g0669100]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 3]]
 
[[Category:Chromosome 3]]
 

Latest revision as of 05:50, 22 October 2016

The rice Os03g0669100 was reported as RGB1 in 2005 [1] by researchers from the USA.

Annotated Information

Gene Symbol

  • Os03g0669100 <=> RGB1


Cooperate Gene

  • RGA1

Function

  • Gbc and Ga cooperatively function in cellular proliferation and seed fertility


Mutation

  • RGB1 knock-down lines were generated in the wild type and d1-5, a mutant deficient for the heterotrimeric G protein a-subunit (Ga) gene (RGA1). Both transgenic lines showed browning of the lamina joint regions and nodes that could be attributed to a reduction of RGB1 function, as the abnormality was not observed in d1-5. The RGB1 knock-down lines generated in d1-5 were shorter, suggesting RGB1 to be a positive regulator of cellular proliferation, in addition to RGA1. The number of sterile seeds also increased in both RGB1 knock-down lines.


Labs working on this gene

  • Department of Bioscience, Fukui Prefectural University, 4-1-1 Matsuoka Kenjyojima, Eiheiji-cho, Yoshida-gun,Fukui 910-1195, Japan


References

  1. Characterization of a histidine- and alanine-rich protein showing interaction with calreticulin in rice


Structured Information