|
|
| (11 intermediate revisions by 6 users not shown) |
| Line 1: |
Line 1: |
| − | OsAREB1,an ABRE-binding protein responding to ABA and glucosemay, may function as a positive regulator in drought/heat stresses response,
| + | The rice '''''Os06g0211200''''' was reported as '''''OsbZIP46''''' in 2012 <ref name="ref1" /> by researchers from China. |
| − | but a negative regulator in flowering time in Arabidopsis<ref name="refA" />.
| |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | ===Function=== | | ===Function=== |
| − | Firstly, overexpression of ''OsAREB1'' alters seedling sensitivity to ABA and glucose and OsAREB1 might have a crucial role in these two
| + | * '''''OsbZIP46''''' is one member of the third subfamily of bZIP transcription factors in rice (Oryza sativa) |
| − | signaling pathways. Roots of transgenic plants were hypersensitive to ABA. Also,transgenic seeds were hypersensitive to glucose in germination period.
| + | * '''''OsbZIP46''''' is a positive regulator of ABA signaling and drought stress tolerance of rice depending on its activation. |
| − | Secondly, 35S-OsAREB1 plants enhanced the resistance to drought and heat.Transgenic seeds can hold more water to stand against drought condition and up-regulate stress-related genes, such as ''RD29A'', ''RD29B''.
| + | * The stress-related genes activated by '''''OsbZIP46CA1''''' are largely different from those activated by the other rice ABF/AREB homologs (such as OsbZIP23), further implying the value of '''''OsbZIP46CA1''''' in genetic engineering of drought tolerance. |
| − | Thirdly, OsAREB1 delay the flowering time.by down-regulating the expression of flowering-related genes, such
| + | |
| − | as ''FT'', SOC1, ''LFY''and ''AP1''. | + | ===Phenotypic analysis=== |
| − | In other work ,A number of transcription factors
| + | * Overexpression of the native '''''OsbZIP46''''' gene increased ABA sensitivity but had no positive effect on drought resistance. |
| − | (TFs) regulate stress-responsive gene expression. OsDREB1s and OsDREB2s were identified as abiotic-stress | + | * The activation domain of '''''OsbZIP46''''' was defined by a series of deletions, and a region (domain D) was identified as having a negative effect on the activation. We produced a constitutive active form of '''''OsbZIP46''''' (OsbZIP46CA1) with a deletion of domain D. Overexpression of '''''OsbZIP46CA1''''' in rice significantly increased tolerance to drought and osmotic stresses. |
| − | responsive TFs that belong to the AP2/ERF family. Similar to Arabidopsis, these DREB regulons were most likely not
| + | * Gene chip analysis of the two overexpressors (native '''''OsbZIP46''''' and the constitutive active form '''''OsbZIP46CA'''''1) revealed that a large number of stress-related genes, many of them predicted to be downstream genes of ABF/ AREBs, were activated in the '''''OsbZIP46CA1 '''''overexpressor but not (even down-regulated) in the '''''OsbZIP46''''' overexpressor. |
| − | involved in the abscisic acid (ABA) pathway. OsAREBs such as OsAREB1 were identified as key components in ABAdependent transcriptional networks in rice.
| + | * '''''OsbZIP46''''' can interact with homologs of SnRK2 protein kinases that phosphorylate ABFs in Arabidopsis. |
| − | <ref name="refC" />
| + | |
| − | The abscisic acid (ABA) responsive element (ABRE)
| |
| − | binding protein (AREB)/ABRE binding factor (ABF) regulon functions in ABA-dependent gene expression
| |
| − | under osmotic stress conditions
| |
| | ===Expression=== | | ===Expression=== |
| − | Expression patterns of the ''OsAREB1'' gene under various environmental stresses and hormones were analyzed by RT-PCR. | + | * Expression of '''''OsbZIP46''''' was strongly induced by drought, heat, hydrogen peroxide, and abscisic acid (ABA) treatment; however, it was not induced by salt and cold stresses. |
| − | OsAREB1 gene was induced within 1 or 2 h under 100 μM ABA and 15% PEG 6,000 treatments, and maintained the expression level for at least 8 hours. It’s expression was induced by heat within 1 h, and rapidly reached the top expression level within 2 h, then declined to initial level.
| |
| − | OsAREB1 was not induced by KT, MeJA, NaCl and cold .These results indicated that OsAREB1was induced by exogenous ABA, water stress and heat. This result
| |
| − | was consistent with the report of Lu et al.<ref name="refB" />.
| |
| − | | |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| − | Please input evolution information here.
| + | * '''''OsbZIP46''''' has high sequence similarity to ABA-responsive element binding factor (ABF/AREB) transcription factors ABI5 and OsbZIP23, two transcriptional activators positively regulating stress tolerance in Arabidopsis (Arabidopsis thaliana) and rice, respectively. |
| − | | |
| − | Extending Knowledge
| |
| − | ===Binding activity===
| |
| − | OsAREB1 has ABRE-binding activity in yeast
| |
| − | Blast result indicated that OsAREB1 belongs to ABF subfamily.
| |
| − | Most members of this subfamily can bind to the ABRE cis-element
| |
| − | with a core sequence ACGTGCC. Yeast one-hybrid system was
| |
| − | used to determine the DNA-binding activity of OsAREB1 with
| |
| − | ABRE element. The entire coding region of OsAREB1 was fused
| |
| − | to the GAL4 transcription active domain (TA). The construct
| |
| − | was transformed into yeast (EGY48) harboring ABRE sequence
| |
| − | fused upstream of a lacZreporter gene, and the growth status of
| |
| − | transformants was observed. Yeast cells harboring pPC86 and
| |
| − | G222 could grow on SD medium lacking Trp, while cells only
| |
| − | with G222 could not grow on the selection medium (Fig. 1A).
| |
| − | The colony-lift filter assay suggested that OsAREB1 can bind to
| |
| − | the ABRE cis-element. Shown as Fig. 1B, when the colony grew
| |
| − | on X-gal containing plate, only cells with pPC86-OsAREB1 and
| |
| − | G222 turned blue, cells only with G222 or with both G222 and
| |
| − | pPC86 did not turn blue. This result indicated that only
| |
| − | OsAREB1 can bind to the ABRE cis-element and then active the
| |
| − | expression of lacZ gene. Further, quantificational analysis for
| |
| − | β-galactosidase activity was performed. Compared to the negative control, the relative β-galactosidase activity of the transformants was about four (Fig. 1C), which revealed there’s a distinct enhancement for β-galactosidase activity.
| |
| − | | |
| − | [[File:DNA binding assay.jpg]]
| |
| − | | |
| − | ===AREB regulon===
| |
| − | Abscisic Acid acts as a crucial signal molecule in abiotic
| |
| − | stress responses (Fujita et al. 2011). The ABA content is | |
| − | increased by abiotic stresses, and leads to expression of
| |
| − | numerous genes. Application of exogenous ABA also
| |
| − | stimulates a myriad of genes. ABRE was identified as a
| |
| − | cis-acting element conserved in promoter regions of
| |
| − | ABA-inducible genes.ArabidopsiscDNAs that encode
| |
| − | bZIP-type TFs were screened as ABRE-binding proteins
| |
| − | (Yamaguchi-Shinozaki & Shinozaki 2006). Among these | |
| − | genes,AREB1/ABF2, AREB2/ABF4,andABF3were
| |
| − | reported to be induced by ABA and osmotic stress in
| |
| − | vegetative tissues (Fujita et al. 2011,). Evidence indicates
| |
| − | that activation of AREB1 needs ABA-dependent posttranscriptional modification. The ABA-activated SnRK2
| |
| − | protein kinases phosphorylate the AREB1 protein (Furihata et al. 2006). TransgenicArabidopsisplants overexpressing the phosphorylated active form of AREB1
| |
| − | showed enhanced expression of a number of ABA-inducible genes (Furihata et al. 2006). The ABA-activated
| |
| − | phosphorylation of AREB/ABFs was completely
| |
| − | impaired in the SnRK2 triple mutant, srk2d srk2e srk2i
| |
| − | (Fujii et al. 2009,; Fujii & Zhu 2009). The down-regulated genes in the srk2d srk2e srk2i andareb1 areb2
| |
| − | abf3triple mutants largely overlapped in ABA-dependent expression, which supports the view that SRK2D/
| |
| − | E/I regulate AREBs in ABA signaling in response to
| |
| − | osmotic stress. (Fujita et al. 2009).
| |
| | | | |
| | You can also add sub-section(s) at will. | | You can also add sub-section(s) at will. |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | 1
| + | * National Key Laboratory of Crop Genetic Improvement and National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China |
| − | Biotechnology Research Institute, Shanghai Academy of Agricultural Sciences, Shanghai,
| |
| − | 2
| |
| − | College of Life Science and Technology,
| |
| − | Yangzhou University, Jiangsu, PR China
| |
| | | | |
| | ==References== | | ==References== |
| − | <ref name="refA" /> Lu, G. J., Gao, C. X., Zheng, X. N. and Han, B. (2009) Identification of OsbZIP72 as a positive regulator of ABA response and drought tolerance in rice. Planta 229, 605-615. | + | <references> |
| − | | + | * <ref name="ref1"> |
| − | <ref name="refC" /> Daisuke Todaka
| + | Tang N, Zhang H, Li X, Xiao J, Xiong L. Constitutive activation of |
| − | 1, Kazuo Nakashima1, Kazuo Shinozaki2and Kazuko Yamaguchi-Shinozaki1,3*(2012) Toward understanding transcriptional regulatorynetworks in abiotic stress responses and tolerance in rice Rice 2012,5:6
| + | transcription factor OsbZIP46 improves drought tolerance in rice. Plant Physiol. |
| − | | + | 2012 Apr;158(4):1755-68. doi: 10.1104/pp.111.190389. Epub 2012 Feb 1. PubMed |
| − | <ref name="refB" />Jin XF1, Xiong AS, Peng RH, Liu JG, Gao F, Chen JM, Yao QH. (2010) OsAREB1, an ABRE-binding protein responding to ABA and glucose, has multiple functions in Arabidopsis.BMB Rep 43(1):34-9.
| + | PMID: 22301130; PubMed Central PMCID: PMC3320183. |
| − | | + | </ref> |
| − | | + | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os06g0211200|
| |
| − | Description = Similar to Abscisic acid responsive elements-binding factor (ABA-responsive element binding protein 1) (AREB1)|
| |
| − | Version = NM_001063653.1 GI:115467037 GeneID:4340462|
| |
| − | Length = 4829 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os06g0211200, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
| |
| − | AP = Chromosome 6:5676158..5680986|
| |
| − | CDS = 5676361..5677152,5677846..5677917,5678514..5678543,5680499..5680575,5680665..5680668<br>|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008399:5676158..5680986
| |
| − | source=RiceChromosome06
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008399:5676158..5680986
| |
| − | source=RiceChromosome06
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggagttgccggcggatgggagcgcgctggcgaggcaggggtcgatctactcgctgacgttcgacgagttccagagcgcgctgggaagcgccgagaaggatttcgggtcgatgaacatggatgagctgctgcgcaacatctggacggcggaggagtcgcaggccatagcgccggcggcggcggctgcttcggcggcggcggtggttggggacgcgcagcagcagcagcagccgatccagaggcaggggtcgctgacgctgccacgcacgctgagccagaagacggtggacgaggtgtggcgcgacatcatgggcttgggcggcagcgacgacgaagaccccgcggcggcggcggctgcggcggcgcccgcgcagcggcagccgacgctgggggagatgacgctggaggagttcctggtgcgggccggcgtcgtgcgggaggacatggggcagaccatcgtgctgccgccgcaggcgcaggcgttgttccccgggagcaatgtggtcgccccggccatgcagctcgccaacgggatgctgcctggtgtcgtcggcgtcgcccccggcgccgccgccgcgatgacggtggcggcgccggccacgccggtggtgctgaacgggctggggaaggtggagggcggggatctctcgtcgctctcgccggtgccttacccattcgacaccgcgctcagggtgaggaagggccctaccgtcgagaaggtggtggagaggcggcagaggcggatgatcaagaacagggagtccgctgctaggtctcgcgcgcggaagcaggcttatataatggagttggaagctgaggtggcaaaactgaaggaacagaaggctgaattgcagaaaaagcaggtggaaatgatacagaagcaaaatgatgaggtcatggagagaatcactcagcaacttggaccaaaggcaaagagattttgcctccgacgaacactgactggtccatgctga</cdnaseq>|
| |
| − | AA = <aaseq>MELPADGSALARQGSIYSLTFDEFQSALGSAEKDFGSMNMDELL RNIWTAEESQAIAPAAAAASAAAVVGDAQQQQQPIQRQGSLTLPRTLSQKTVDEVWRD IMGLGGSDDEDPAAAAAAAAPAQRQPTLGEMTLEEFLVRAGVVREDMGQTIVLPPQAQ ALFPGSNVVAPAMQLANGMLPGVVGVAPGAAAAMTVAAPATPVVLNGLGKVEGGDLSS LSPVPYPFDTALRVRKGPTVEKVVERRQRRMIKNRESAARSRARKQAYIMELEAEVAK LKEQKAELQKKQVEMIQKQNDEVMERITQQLGPKAKRFCLRRTLTGPC</aaseq>|
| |
| − | DNA = <dnaseqindica>204..995#1689..1760#2357..2386#4342..4418#4508..4511#gattaaacctgatttccccttgctaattcgggccatcgcatcactcccccaactaatcacactcctctcttctccgcttcctcttctcgtatatttataaccccacttcccttttcttcctctttcttctcatcttggtttcttcctagtttcgggagaggattttagtgagggatttgaaggattttgaggtgggagaggagatggagttgccggcggatgggagcgcgctggcgaggcaggggtcgatctactcgctgacgttcgacgagttccagagcgcgctgggaagcgccgagaaggatttcgggtcgatgaacatggatgagctgctgcgcaacatctggacggcggaggagtcgcaggccatagcgccggcggcggcggctgcttcggcggcggcggtggttggggacgcgcagcagcagcagcagccgatccagaggcaggggtcgctgacgctgccacgcacgctgagccagaagacggtggacgaggtgtggcgcgacatcatgggcttgggcggcagcgacgacgaagaccccgcggcggcggcggctgcggcggcgcccgcgcagcggcagccgacgctgggggagatgacgctggaggagttcctggtgcgggccggcgtcgtgcgggaggacatggggcagaccatcgtgctgccgccgcaggcgcaggcgttgttccccgggagcaatgtggtcgccccggccatgcagctcgccaacgggatgctgcctggtgtcgtcggcgtcgcccccggcgccgccgccgcgatgacggtggcggcgccggccacgccggtggtgctgaacgggctggggaaggtggagggcggggatctctcgtcgctctcgccggtgccttacccattcgacaccgcgctcagggtgaggaagggccctaccgtcgagaaggtggtggagaggcggcagaggcggatgatcaagaacagggagtccgctgctaggtctcgcgcgcggaagcaggtgaagcctctcttctcttcaactgcactaggatgtaggaatacgtagcaatcttatgtccatttgcttgattaattagttctgaaaattcgatggtgcctatatttggtatgcctctcgataatgctgtactttattcacatgatgtgatccccccacttctaattcagcttgtagatgttaatttatgcctaatagccactgcaaatagcaagttagcgtcgttaaatattgttcaaccacagaggataagaatctaaagtgaataagccatggttcaagttgatgctctcagattcagagagatgatgagtggctttgttcatttcgggacactggctgagcggtgtttttttttttttttggatcgactattgctgtgatagggatagcatgctcaccatgaagcttggaaggacaattgacaagaccaattcgagaaatagtaacttccgttgatcttttctttaaaaaaaaaacttgtgggggtaataggtcttttttatgtgcaagttgtgctgccatgatgcactcatacttctataaaagctagtatatacttttattgttctaacatagcaaggtcaagtctttctgatactctgattgacagagaatagttctagacagttatggttgtgttgcgaaacacaattttttaacattaaattttggctttctgatatacaacaggcttatataatggagttggaagctgaggtggcaaaactgaaggaacagaaggctgaattgcagaaaaagcaggtatacctgctgtcatataaaattgctttgatccatgcatactctttatttttttctgtttctcttaccaattcctgtaatcagttagtagtccttagataacctcttgactttggataattcctatgtttcttgcctcgattgtcatatttgtttggggatttgggcttaccaatggctgttgttttaatctacccccagcaatgcttgttgctggtattgcaatatgtaggtgaccacaaatagcattcaaatgtccttgttctatgtatttcctgtggaatttatctgagttcaaatctttaatggttgttggaggtttgcacttaaaaggtgtatccctttttaatttgaacattgatggggttacattaattttgtattactgtcctgcaaacttgtattgaaatcctatgccatctggtatcttcttgttcacacattttccatgtgcctactattgttatgccagtatgtcattgtatcatgattttgtaattgaataacttaacaaaagcaccaaaccttttcttcttccaaattcctgacaaaaaatccatgaagctttattcacttattatgcttctaatttgcaggtggaaatgatacagaagcaaaatgatgaggtaatgaccttacagttggtagtaaataccatggttctgaattcgcactatgtttgtcctcattgatgtggaagttgtctatacctctttttgatcataccatactttcttcttttttaaataaaaaacaagagtaagttcatttccacaaacttgctgattaagggatctttggatctgggtgaattttttggggcatttgcaagtttggactaaagttctgatgacttgaatccagataccctctatatccaaacagacccaaattggggcaaaacaacaagctaactctatcgaaccaattcgtttttcttgctgtgagcctttcctaaaactggcagacgccttagaatctccatggctgaagtttgtcaaagtgcacaacaacagtagcattaggtcatttattagagctgcatgacattcaaattctttttaatgagctgcacaacaacatgcacgatttcccaattctggctgtgaggtgtgtttgttattgcattttttgtggtcatgtcagaaaatatcttactacatatggtttaaattatgtttcagaaatcccttattctttaaccaactgccatcataaatgtatatgctggtgttggccatatatttcatgtcactgacactctggcctcttatcccttctcattttcattcatgtatcatgttatctatgtagggtcattgtgttacatccatcttcagttttttaacactttagtgccatccacttgtggttttttttttcataaaataaatttgaagaaactaacagagatatgcaatactggaactcctgccattgcaatagaaaattagcacatcatgattttcagctatcacagtgtggattactgtgatgtgttttttgttaaaaaaaaatgtacactactttgtcctacactcgtccctgctgtcaaataattgagtttgccatgtacagagtaaatgtccagatgtgcaccattctgaatatggtatcccattttgggcatgcatgcttgtaacaccaaaattctgttggagaacatactacccaataagctcaaggtttcattttcaaaatctagttatctgtaattcccatgtcattatagttaaagtatttaattttctaccttctgttttatttttaactaatcagttcaattttttaaccaaagaatgatactcttttaccagggagatctgaagtgacttattggacatacaatgctaaaacaacaaactaaaacaacaaaatggacattgggtaggtttgtctgggtggtatgctcaacccagtctgatctggagtattaaaaagaatcctgactctaaatttagtccaccgctactatagacgctatagtgagcctgtccagcattcaaattaaggacattagttgtgttcgtttctaatggttgggaaccttccccctctagcatgtaaaacggagcaacgatttagcacacgatcaattaagtattagctaaaaaaaacttgaaaaaatggattaatataattttttaaaccaacttttctatagaaagtttttctagaaaacacattgtttagcagttttggaagcgtgcgtgcggaaaacaagtgagtagaggtgggaaagtgtagggaagatgtcatgttggtttgaattttgaaagtctgcaaactcttactaatgttacataaatagttttggttgctactctgcggtttcaagcagtaaacctctgcctcaatcattctgaagtttaagcatttctttgattataatcagtacagttagaaggccttaactgggtgcatttttatgttccgacttctgacgatctcactgaaatctgacaagtgttttctagctgaagatagtacattttactagatgctttgcaatgttgagaaagttctcttcatagattcttctttccctaacaggagttttatctataaatggattttgcaggtcatggagagaatcactcagcaacttggaccaaaggcaaagagattttgcctccgacgaacactgactggtccatggtaagttgatcaagtttgcacagcattgaccaaagttaagatcgttggcttccttggatgtgaccaatcgccgcgtgtatatatatcagctgaagccagagtctccggtttcgccgtggcgctcagcttcagagttgcttctctccttgttggtgaatggtgatggctcagtctcttggacggtcgaatgctggcgtcgattactcactaggtttagctgcgagatcgttgcgtgagcaaaggcatactatctaatctgtttaactccttatttagggaaatctggcatggtgaaaacggggcatgccatctgtgtttgttgtttttgtgcagctgttgcatctgctctgtatgttgctgttgcgttgacatgtcatcccgtttacagttcagtgattctgttctgtaccc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063653.1 RefSeq:Os06g0211200]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |