Difference between revisions of "Os06g0211200"

From RiceWiki
Jump to: navigation, search
(Function)
 
(10 intermediate revisions by 5 users not shown)
Line 1: Line 1:
OsAREB1,an ABRE-binding protein responding to ABA and glucosemay, may function as a positive regulator in drought/heat stresses response,
+
The rice '''''Os06g0211200''''' was reported as '''''OsbZIP46''''' in 2012 <ref name="ref1" /> by researchers from China.  
but a negative regulator in flowering time in Arabidopsis<ref name="refA" />.
 
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Firstly, overexpression of ''OsAREB1'' alters seedling sensitivity to ABA and glucose and OsAREB1 might have a crucial role in these two
+
* '''''OsbZIP46''''' is one member of the third subfamily of bZIP transcription factors in rice (Oryza sativa)
signaling pathways. Roots of transgenic plants were hypersensitive to ABA. Also,transgenic seeds were hypersensitive to glucose in germination period.
+
* '''''OsbZIP46''''' is a positive regulator of ABA signaling and drought stress tolerance of rice depending on its activation.
 +
* The stress-related genes activated by '''''OsbZIP46CA1''''' are largely different from those activated by the other rice ABF/AREB homologs (such as OsbZIP23), further implying the value of '''''OsbZIP46CA1''''' in genetic engineering of drought tolerance.
  
Secondly, 35S-OsAREB1 plants enhanced the resistance to drought and heat.Transgenic seeds can hold more water to stand against drought condition and up-regulate stress-related genes, such as ''RD29A'', ''RD29B''.
+
===Phenotypic analysis===
 
+
* Overexpression of the native '''''OsbZIP46''''' gene increased ABA sensitivity but had no positive effect on drought resistance.  
Thirdly, OsAREB1 delay the flowering time.by down-regulating the expression of flowering-related genes, such
+
* The activation domain of '''''OsbZIP46''''' was defined by a series of deletions, and a region (domain D) was identified as having a negative effect on the activation. We produced a constitutive active form of '''''OsbZIP46''''' (OsbZIP46CA1) with a deletion of domain D. Overexpression of '''''OsbZIP46CA1''''' in rice significantly increased tolerance to drought and osmotic stresses.  
as ''FT'', SOC1, ''LFY''and ''AP1''.
+
* Gene chip analysis of the two overexpressors (native '''''OsbZIP46''''' and the constitutive active form '''''OsbZIP46CA'''''1) revealed that a large number of stress-related genes, many of them predicted to be downstream genes of ABF/ AREBs, were activated in the '''''OsbZIP46CA1 '''''overexpressor but not (even down-regulated) in the '''''OsbZIP46''''' overexpressor.  
 
+
* '''''OsbZIP46''''' can interact with homologs of SnRK2 protein kinases that phosphorylate ABFs in Arabidopsis.
In other work ,A number of transcription factors
 
(TFs) regulate stress-responsive gene expression. OsDREB1s and OsDREB2s were identified as abiotic-stress
 
responsive TFs that belong to the AP2/ERF family. Similar to Arabidopsis, these DREB regulons were most likely not
 
involved in the abscisic acid (ABA) pathway. OsAREBs such as OsAREB1 were identified as key components in ABAdependent transcriptional networks in rice.
 
<ref name="refC" />
 
The abscisic acid (ABA) responsive element (ABRE)
 
binding protein (AREB)/ABRE binding factor (ABF) regulon functions in ABA-dependent gene expression
 
under osmotic stress conditions
 
  
 
===Expression===
 
===Expression===
Expression patterns of the ''OsAREB1'' gene under various environmental stresses and hormones were analyzed by RT-PCR.
+
* Expression of '''''OsbZIP46''''' was strongly induced by drought, heat, hydrogen peroxide, and abscisic acid (ABA) treatment; however, it was not induced by salt and cold stresses.
OsAREB1 gene was induced within 1 or 2 h under 100 μM ABA and 15% PEG 6,000 treatments, and maintained the expression level for at least 8 hours. It’s expression was induced by heat within 1 h, and rapidly reached the top expression level within 2 h, then declined to initial level.
 
OsAREB1 was not induced by KT, MeJA, NaCl and cold .These results indicated that OsAREB1was induced by exogenous ABA, water stress and heat. This result
 
was consistent with the report of Lu et al.<ref name="refB" />.
 
 
 
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* '''''OsbZIP46''''' has high sequence similarity to ABA-responsive element binding factor (ABF/AREB) transcription factors ABI5 and OsbZIP23, two transcriptional activators positively regulating stress tolerance in Arabidopsis (Arabidopsis thaliana) and rice, respectively.
 
 
Extending Knowledge
 
===Binding activity===
 
OsAREB1 has ABRE-binding activity in yeast
 
Blast result indicated that OsAREB1 belongs to ABF subfamily.
 
Most members of this subfamily can bind to the ABRE cis-element  
 
with a core sequence ACGTGCC. Yeast one-hybrid system was
 
used to determine the DNA-binding activity of OsAREB1 with
 
ABRE element. The entire coding region of OsAREB1 was fused
 
to the GAL4 transcription active domain (TA). The construct
 
was transformed into yeast (EGY48) harboring ABRE sequence
 
fused upstream of a lacZreporter gene, and the growth status of
 
transformants was observed. Yeast cells harboring pPC86 and
 
G222 could grow on SD medium lacking Trp, while cells only
 
with G222 could not grow on the selection medium (Fig. 1A).
 
The colony-lift filter assay suggested that OsAREB1 can bind to
 
the ABRE cis-element. Shown as Fig. 1B, when the colony grew
 
on X-gal containing plate, only cells with pPC86-OsAREB1 and
 
G222 turned blue, cells only with G222 or with both G222 and  
 
pPC86 did not turn blue. This result indicated that only
 
OsAREB1 can bind to the ABRE cis-element and then active the
 
expression of lacZ gene. Further, quantificational analysis for
 
β-galactosidase activity was performed. Compared to the negative control, the relative β-galactosidase activity of the transformants was about four (Fig. 1C), which revealed there’s a distinct enhancement for β-galactosidase activity.
 
 
 
[[File:DNA binding assay.jpg]]
 
 
 
===AREB regulon===
 
Abscisic Acid acts as a crucial signal molecule in abiotic
 
stress responses (Fujita et al. 2011). The ABA content is
 
increased by abiotic stresses, and leads to expression of
 
numerous genes. Application of exogenous ABA also
 
stimulates a myriad of genes. ABRE was identified as a
 
cis-acting element conserved in promoter regions of
 
ABA-inducible genes.ArabidopsiscDNAs that encode
 
bZIP-type TFs were screened as ABRE-binding proteins
 
(Yamaguchi-Shinozaki & Shinozaki 2006). Among these
 
genes,AREB1/ABF2, AREB2/ABF4,andABF3were
 
reported to be induced by ABA and osmotic stress in
 
vegetative tissues (Fujita et al. 2011,). Evidence indicates
 
that activation of AREB1 needs ABA-dependent posttranscriptional modification. The ABA-activated SnRK2
 
protein kinases phosphorylate the AREB1 protein (Furihata et al. 2006). TransgenicArabidopsisplants overexpressing the phosphorylated active form of AREB1
 
showed enhanced expression of a number of ABA-inducible genes (Furihata et al. 2006). The ABA-activated
 
phosphorylation of AREB/ABFs was completely
 
impaired in the SnRK2 triple mutant, srk2d srk2e srk2i
 
(Fujii et al. 2009,; Fujii & Zhu 2009). The down-regulated genes in the srk2d srk2e srk2i andareb1 areb2
 
abf3triple mutants largely overlapped in ABA-dependent expression, which supports the view that SRK2D/
 
E/I regulate AREBs in ABA signaling in response to
 
osmotic stress. (Fujita et al. 2009).
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
1
+
* National Key Laboratory of Crop Genetic Improvement and National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China
Biotechnology Research Institute, Shanghai Academy of Agricultural Sciences, Shanghai,
 
2
 
College of Life Science and Technology,
 
Yangzhou University, Jiangsu, PR China
 
  
 
==References==
 
==References==
<ref name="refA" /> Lu, G. J., Gao, C. X., Zheng, X. N. and Han, B. (2009) Identification of OsbZIP72 as a positive regulator of ABA response and drought tolerance in rice. Planta  229, 605-615.
+
<references>
 
+
* <ref name="ref1">
<ref name="refC" /> Daisuke Todaka
+
Tang N, Zhang H, Li X, Xiao J, Xiong L. Constitutive activation of
1, Kazuo Nakashima1, Kazuo Shinozaki2and Kazuko Yamaguchi-Shinozaki1,3*(2012) Toward understanding transcriptional regulatorynetworks in abiotic stress responses and tolerance in rice  Rice 2012,5:6
+
transcription factor OsbZIP46 improves drought tolerance in rice. Plant Physiol.  
 
+
2012 Apr;158(4):1755-68. doi: 10.1104/pp.111.190389. Epub 2012 Feb 1. PubMed
<ref name="refB" />Jin XF1, Xiong AS, Peng RH, Liu JG, Gao F, Chen JM, Yao QH. (2010) OsAREB1, an ABRE-binding protein responding to ABA and glucose, has multiple functions in Arabidopsis.BMB Rep 43(1):34-9.
+
PMID: 22301130; PubMed Central PMCID: PMC3320183.
 
+
</ref>
 
+
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os06g0211200|
 
Description = Similar to Abscisic acid responsive elements-binding factor (ABA-responsive element binding protein 1) (AREB1)|
 
Version = NM_001063653.1 GI:115467037 GeneID:4340462|
 
Length = 4829 bp|
 
Definition = Oryza sativa Japonica Group Os06g0211200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
 
AP = Chromosome 6:5676158..5680986|
 
CDS = 5676361..5677152,5677846..5677917,5678514..5678543,5680499..5680575,5680665..5680668<br>|
 
GCID = <gbrowseImage1>
 
name=NC_008399:5676158..5680986
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008399:5676158..5680986
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggagttgccggcggatgggagcgcgctggcgaggcaggggtcgatctactcgctgacgttcgacgagttccagagcgcgctgggaagcgccgagaaggatttcgggtcgatgaacatggatgagctgctgcgcaacatctggacggcggaggagtcgcaggccatagcgccggcggcggcggctgcttcggcggcggcggtggttggggacgcgcagcagcagcagcagccgatccagaggcaggggtcgctgacgctgccacgcacgctgagccagaagacggtggacgaggtgtggcgcgacatcatgggcttgggcggcagcgacgacgaagaccccgcggcggcggcggctgcggcggcgcccgcgcagcggcagccgacgctgggggagatgacgctggaggagttcctggtgcgggccggcgtcgtgcgggaggacatggggcagaccatcgtgctgccgccgcaggcgcaggcgttgttccccgggagcaatgtggtcgccccggccatgcagctcgccaacgggatgctgcctggtgtcgtcggcgtcgcccccggcgccgccgccgcgatgacggtggcggcgccggccacgccggtggtgctgaacgggctggggaaggtggagggcggggatctctcgtcgctctcgccggtgccttacccattcgacaccgcgctcagggtgaggaagggccctaccgtcgagaaggtggtggagaggcggcagaggcggatgatcaagaacagggagtccgctgctaggtctcgcgcgcggaagcaggcttatataatggagttggaagctgaggtggcaaaactgaaggaacagaaggctgaattgcagaaaaagcaggtggaaatgatacagaagcaaaatgatgaggtcatggagagaatcactcagcaacttggaccaaaggcaaagagattttgcctccgacgaacactgactggtccatgctga</cdnaseq>|
 
AA = <aaseq>MELPADGSALARQGSIYSLTFDEFQSALGSAEKDFGSMNMDELL                    RNIWTAEESQAIAPAAAAASAAAVVGDAQQQQQPIQRQGSLTLPRTLSQKTVDEVWRD                    IMGLGGSDDEDPAAAAAAAAPAQRQPTLGEMTLEEFLVRAGVVREDMGQTIVLPPQAQ                    ALFPGSNVVAPAMQLANGMLPGVVGVAPGAAAAMTVAAPATPVVLNGLGKVEGGDLSS                    LSPVPYPFDTALRVRKGPTVEKVVERRQRRMIKNRESAARSRARKQAYIMELEAEVAK                    LKEQKAELQKKQVEMIQKQNDEVMERITQQLGPKAKRFCLRRTLTGPC</aaseq>|
 
DNA = <dnaseqindica>204..995#1689..1760#2357..2386#4342..4418#4508..4511#gattaaacctgatttccccttgctaattcgggccatcgcatcactcccccaactaatcacactcctctcttctccgcttcctcttctcgtatatttataaccccacttcccttttcttcctctttcttctcatcttggtttcttcctagtttcgggagaggattttagtgagggatttgaaggattttgaggtgggagaggagatggagttgccggcggatgggagcgcgctggcgaggcaggggtcgatctactcgctgacgttcgacgagttccagagcgcgctgggaagcgccgagaaggatttcgggtcgatgaacatggatgagctgctgcgcaacatctggacggcggaggagtcgcaggccatagcgccggcggcggcggctgcttcggcggcggcggtggttggggacgcgcagcagcagcagcagccgatccagaggcaggggtcgctgacgctgccacgcacgctgagccagaagacggtggacgaggtgtggcgcgacatcatgggcttgggcggcagcgacgacgaagaccccgcggcggcggcggctgcggcggcgcccgcgcagcggcagccgacgctgggggagatgacgctggaggagttcctggtgcgggccggcgtcgtgcgggaggacatggggcagaccatcgtgctgccgccgcaggcgcaggcgttgttccccgggagcaatgtggtcgccccggccatgcagctcgccaacgggatgctgcctggtgtcgtcggcgtcgcccccggcgccgccgccgcgatgacggtggcggcgccggccacgccggtggtgctgaacgggctggggaaggtggagggcggggatctctcgtcgctctcgccggtgccttacccattcgacaccgcgctcagggtgaggaagggccctaccgtcgagaaggtggtggagaggcggcagaggcggatgatcaagaacagggagtccgctgctaggtctcgcgcgcggaagcaggtgaagcctctcttctcttcaactgcactaggatgtaggaatacgtagcaatcttatgtccatttgcttgattaattagttctgaaaattcgatggtgcctatatttggtatgcctctcgataatgctgtactttattcacatgatgtgatccccccacttctaattcagcttgtagatgttaatttatgcctaatagccactgcaaatagcaagttagcgtcgttaaatattgttcaaccacagaggataagaatctaaagtgaataagccatggttcaagttgatgctctcagattcagagagatgatgagtggctttgttcatttcgggacactggctgagcggtgtttttttttttttttggatcgactattgctgtgatagggatagcatgctcaccatgaagcttggaaggacaattgacaagaccaattcgagaaatagtaacttccgttgatcttttctttaaaaaaaaaacttgtgggggtaataggtcttttttatgtgcaagttgtgctgccatgatgcactcatacttctataaaagctagtatatacttttattgttctaacatagcaaggtcaagtctttctgatactctgattgacagagaatagttctagacagttatggttgtgttgcgaaacacaattttttaacattaaattttggctttctgatatacaacaggcttatataatggagttggaagctgaggtggcaaaactgaaggaacagaaggctgaattgcagaaaaagcaggtatacctgctgtcatataaaattgctttgatccatgcatactctttatttttttctgtttctcttaccaattcctgtaatcagttagtagtccttagataacctcttgactttggataattcctatgtttcttgcctcgattgtcatatttgtttggggatttgggcttaccaatggctgttgttttaatctacccccagcaatgcttgttgctggtattgcaatatgtaggtgaccacaaatagcattcaaatgtccttgttctatgtatttcctgtggaatttatctgagttcaaatctttaatggttgttggaggtttgcacttaaaaggtgtatccctttttaatttgaacattgatggggttacattaattttgtattactgtcctgcaaacttgtattgaaatcctatgccatctggtatcttcttgttcacacattttccatgtgcctactattgttatgccagtatgtcattgtatcatgattttgtaattgaataacttaacaaaagcaccaaaccttttcttcttccaaattcctgacaaaaaatccatgaagctttattcacttattatgcttctaatttgcaggtggaaatgatacagaagcaaaatgatgaggtaatgaccttacagttggtagtaaataccatggttctgaattcgcactatgtttgtcctcattgatgtggaagttgtctatacctctttttgatcataccatactttcttcttttttaaataaaaaacaagagtaagttcatttccacaaacttgctgattaagggatctttggatctgggtgaattttttggggcatttgcaagtttggactaaagttctgatgacttgaatccagataccctctatatccaaacagacccaaattggggcaaaacaacaagctaactctatcgaaccaattcgtttttcttgctgtgagcctttcctaaaactggcagacgccttagaatctccatggctgaagtttgtcaaagtgcacaacaacagtagcattaggtcatttattagagctgcatgacattcaaattctttttaatgagctgcacaacaacatgcacgatttcccaattctggctgtgaggtgtgtttgttattgcattttttgtggtcatgtcagaaaatatcttactacatatggtttaaattatgtttcagaaatcccttattctttaaccaactgccatcataaatgtatatgctggtgttggccatatatttcatgtcactgacactctggcctcttatcccttctcattttcattcatgtatcatgttatctatgtagggtcattgtgttacatccatcttcagttttttaacactttagtgccatccacttgtggttttttttttcataaaataaatttgaagaaactaacagagatatgcaatactggaactcctgccattgcaatagaaaattagcacatcatgattttcagctatcacagtgtggattactgtgatgtgttttttgttaaaaaaaaatgtacactactttgtcctacactcgtccctgctgtcaaataattgagtttgccatgtacagagtaaatgtccagatgtgcaccattctgaatatggtatcccattttgggcatgcatgcttgtaacaccaaaattctgttggagaacatactacccaataagctcaaggtttcattttcaaaatctagttatctgtaattcccatgtcattatagttaaagtatttaattttctaccttctgttttatttttaactaatcagttcaattttttaaccaaagaatgatactcttttaccagggagatctgaagtgacttattggacatacaatgctaaaacaacaaactaaaacaacaaaatggacattgggtaggtttgtctgggtggtatgctcaacccagtctgatctggagtattaaaaagaatcctgactctaaatttagtccaccgctactatagacgctatagtgagcctgtccagcattcaaattaaggacattagttgtgttcgtttctaatggttgggaaccttccccctctagcatgtaaaacggagcaacgatttagcacacgatcaattaagtattagctaaaaaaaacttgaaaaaatggattaatataattttttaaaccaacttttctatagaaagtttttctagaaaacacattgtttagcagttttggaagcgtgcgtgcggaaaacaagtgagtagaggtgggaaagtgtagggaagatgtcatgttggtttgaattttgaaagtctgcaaactcttactaatgttacataaatagttttggttgctactctgcggtttcaagcagtaaacctctgcctcaatcattctgaagtttaagcatttctttgattataatcagtacagttagaaggccttaactgggtgcatttttatgttccgacttctgacgatctcactgaaatctgacaagtgttttctagctgaagatagtacattttactagatgctttgcaatgttgagaaagttctcttcatagattcttctttccctaacaggagttttatctataaatggattttgcaggtcatggagagaatcactcagcaacttggaccaaaggcaaagagattttgcctccgacgaacactgactggtccatggtaagttgatcaagtttgcacagcattgaccaaagttaagatcgttggcttccttggatgtgaccaatcgccgcgtgtatatatatcagctgaagccagagtctccggtttcgccgtggcgctcagcttcagagttgcttctctccttgttggtgaatggtgatggctcagtctcttggacggtcgaatgctggcgtcgattactcactaggtttagctgcgagatcgttgcgtgagcaaaggcatactatctaatctgtttaactccttatttagggaaatctggcatggtgaaaacggggcatgccatctgtgtttgttgtttttgtgcagctgttgcatctgctctgtatgttgctgttgcgttgacatgtcatcccgtttacagttcagtgattctgttctgtaccc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063653.1 RefSeq:Os06g0211200]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 05:53, 22 October 2016

The rice Os06g0211200 was reported as OsbZIP46 in 2012 [1] by researchers from China.

Annotated Information

Function

  • OsbZIP46 is one member of the third subfamily of bZIP transcription factors in rice (Oryza sativa)
  • OsbZIP46 is a positive regulator of ABA signaling and drought stress tolerance of rice depending on its activation.
  • The stress-related genes activated by OsbZIP46CA1 are largely different from those activated by the other rice ABF/AREB homologs (such as OsbZIP23), further implying the value of OsbZIP46CA1 in genetic engineering of drought tolerance.

Phenotypic analysis

  • Overexpression of the native OsbZIP46 gene increased ABA sensitivity but had no positive effect on drought resistance.
  • The activation domain of OsbZIP46 was defined by a series of deletions, and a region (domain D) was identified as having a negative effect on the activation. We produced a constitutive active form of OsbZIP46 (OsbZIP46CA1) with a deletion of domain D. Overexpression of OsbZIP46CA1 in rice significantly increased tolerance to drought and osmotic stresses.
  • Gene chip analysis of the two overexpressors (native OsbZIP46 and the constitutive active form OsbZIP46CA1) revealed that a large number of stress-related genes, many of them predicted to be downstream genes of ABF/ AREBs, were activated in the OsbZIP46CA1 overexpressor but not (even down-regulated) in the OsbZIP46 overexpressor.
  • OsbZIP46 can interact with homologs of SnRK2 protein kinases that phosphorylate ABFs in Arabidopsis.

Expression

  • Expression of OsbZIP46 was strongly induced by drought, heat, hydrogen peroxide, and abscisic acid (ABA) treatment; however, it was not induced by salt and cold stresses.

Evolution

  • OsbZIP46 has high sequence similarity to ABA-responsive element binding factor (ABF/AREB) transcription factors ABI5 and OsbZIP23, two transcriptional activators positively regulating stress tolerance in Arabidopsis (Arabidopsis thaliana) and rice, respectively.

You can also add sub-section(s) at will.

Labs working on this gene

  • National Key Laboratory of Crop Genetic Improvement and National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China

References

  1. Tang N, Zhang H, Li X, Xiao J, Xiong L. Constitutive activation of transcription factor OsbZIP46 improves drought tolerance in rice. Plant Physiol. 2012 Apr;158(4):1755-68. doi: 10.1104/pp.111.190389. Epub 2012 Feb 1. PubMed PMID: 22301130; PubMed Central PMCID: PMC3320183.

Structured Information