|
|
| (13 intermediate revisions by 3 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | part of a killer-protector system was found at the S5 locus. ORF3(Os06g0212900) act as the protector to prevent ER stress and produce normal gametes. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | ===Function=== | | ===Function=== |
| − | A killer-protector system was found at the S5 locus encoded by three tightly linked genes [Open Reading Frame 3 (ORF3)to ORF5] regulates fertility in indica japonica hybrids. During female sporogenesis, the action of ORF5+ (killer) and ORF4+ (partner) causes endoplasmic reticulum (ER) stress. ORF3+ (protector) prevents ER stress and produces normal gametes, but ORF3–cannot prevent ER stress, resulting in premature programmed cell death and leads to embryo-sac abortion. Preferential transmission ofORF3+ gametes results in segregation distortion in the progeny. These results add to our understanding of differences betweenindica andjaponica rice and may aid in rice genetic improvement.[[1]] | + | [[File:1.jpg|right|thumb|350px|''Schematic representation of the killer-protector system in an indica-japonica hybrid regulated by the S5 locus.<ref name="ref1" />'']] |
| | + | A killer-protector system was found at the S5 locus encoded by three tightly linked genes [Open Reading Frame 3 (ORF3)to ORF5] regulates fertility in indica japonica hybrids. During female sporogenesis, the action of ORF5+ (killer) and ORF4+ (partner) causes endoplasmic reticulum (ER) stress. ORF3+ (protector) prevents ER stress and produces normal gametes, but ORF3–cannot prevent ER stress, resulting in premature programmed cell death and leads to embryo-sac abortion. Preferential transmission ofORF3+ gametes results in segregation distortion in the progeny. These results add to our understanding of differences betweenindica andjaponica rice and may aid in rice genetic improvement.<ref name="ref1" /> |
| | | | |
| | ===Expression=== | | ===Expression=== |
| Line 14: |
Line 15: |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | * National Key Laboratory of Crop Genetic Improvement and National Centre of Plant Gene Research, Huazhong Agricultural University, Wuhan 430070, China. |
| | + | * School of Life Sciences, Chinese University of Hong Kong, Shatin, New Territories, Hong Kong 999077, China. |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | <references> |
| | + | <ref name="ref1">Jiangyi Yang, Xiaobo Zhao, Ke Cheng, Hongyi Du, Yidan Ouyang, Jiongjiong Chen, Shuqing Qiu, Jianyan Huang, Yunhe Jiang, Liwen Jiang, Jihua Ding, Jia Wang, Caiguo Xu, Xianghua Li, Qifa Zhang. (2012) A Killer-Protector System Regulates Both Hybrid Sterility and Segregation Distortion in Rice. Science 337: 1336-1340.</ref> |
| | + | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os06g0212900|
| |
| − | Description = Heat shock protein Hsp70 family protein|
| |
| − | Version = NM_001063661.1 GI:115467053 GeneID:4340470|
| |
| − | Length = 2022 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os06g0212900, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
| |
| − | AP = Chromosome 6:5744189..5746210|
| |
| − | CDS = 5744384..5744924,5745012..5745469,5745593..5745948,5746038..5746095|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008399:5744189..5746210
| |
| − | source=RiceChromosome06
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008399:5744189..5746210
| |
| − | source=RiceChromosome06
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggggcgtcgtcgtcttctgttgagcgatctactgctgctgctgctcatcgccatcgcggtggcaggggcagcggcggcgatcgcgatcccaagagcggcgccggcgttcggagttgaaactgggtggccgccggagcactgcttgcgctgcttcgctccaccggatgcccccttcgtcctgggcgccgccgcggccatccatctcggcaacaccaactcctgcatcgccggctacgacgacgacgacgctcccctgggggccaagcgtagctactaccagttctgcatcccctcctgggtagccctcgcacacgacaatggcaccgtcatctccggcgaggccgctatgaaccgcgccgccctcagcccctccacagctgtctccgccttcatgcgcctcctacacagaagggtggaggacgatgtggtgaagagagagatagagcttgtgccgtacaagtttaccaagatgctgggatgggtctccgtccaactagacacagatgctgaattctctgtcgaccatctcgccggcatcctcatctcccacctcaagcacacggcggaggcgcacctgggccgccacatcaacaatgctgtcatcaccctacccagtcgactcagctactccgccgatggcaggcaggtcctcagctcggcggcgaaggagtacagcggcttcagggccgtcaaggtcgtcgacgagcacatcgcggcggccgcggcgtatgggcaccacaccaagcagggtgaccgcaaggccatccttgtcttccatctcggcggccgcacctcccacgcaaccatcttcaagttcgtcgacggcacggctcgcctcatcgcgacgcgagctcatcatttcctcggaggtgacgatttcacggcgaggatcgtggaccacatggtggagcacatcaaggagcagcatggcagggacgtacggcaggaggagaaggcaatggtgaggctaagggtggcgtgcgagcacgccaagaaggcactgagcgagcaacaagagaccctggtgcagatggactcgcttctggacgacggcgcggtcttctccgcgacgctgacgcgggccaagttcgaggagctcaaccacgacctgttggacagagccatggcgctggtgaaggaggtggtggtgacgacgggaggagtggaggtggtggacgaggttcttgtcgtcggcggcagcgcgaggattcccaaggttcgtcagctcgtcaaggactacttcaatggcaacggcaatggcacgcacccaaacagtcgcggttgcaaggggccggtggatgtggaaccagaggatgccgtgcttcatggcgccgcgcttctttcccgtcctctacctgttgcagagggaacagcagcagctcggtccatcggttccgtcggaggcatctga</cdnaseq>|
| |
| − | AA = <aaseq>MGRRRLLLSDLLLLLLIAIAVAGAAAAIAIPRAAPAFGVETGWP PEHCLRCFAPPDAPFVLGAAAAIHLGNTNSCIAGYDDDDAPLGAKRSYYQFCIPSWVA LAHDNGTVISGEAAMNRAALSPSTAVSAFMRLLHRRVEDDVVKREIELVPYKFTKMLG WVSVQLDTDAEFSVDHLAGILISHLKHTAEAHLGRHINNAVITLPSRLSYSADGRQVL SSAAKEYSGFRAVKVVDEHIAAAAAYGHHTKQGDRKAILVFHLGGRTSHATIFKFVDG TARLIATRAHHFLGGDDFTARIVDHMVEHIKEQHGRDVRQEEKAMVRLRVACEHAKKA LSEQQETLVQMDSLLDDGAVFSATLTRAKFEELNHDLLDRAMALVKEVVVTTGGVEVV DEVLVVGGSARIPKVRQLVKDYFNGNGNGTHPNSRGCKGPVDVEPEDAVLHGAALLSR PLPVAEGTAAARSIGSVGGI</aaseq>|
| |
| − | DNA = <dnaseqindica>1287..1827#742..1199#263..618#116..173#atagtacctgtgggatcgaaaggcactgacgaactcgatcaagaaggagtagtcctatcatataattgctgattcagtgattcgattccgtcgagactcgagagggaggcgaagcatggggcgtcgtcgtcttctgttgagcgatctactgctgctgctgctcatcgccatcggtgagtagactctgccatcggatggacacactagtacttgtaattaattaattaatattttgtctcttgagctttcctcccccttgcagcggtggcaggggcagcggcggcgatcgcgatcccaagagcggcgccggcgttcggagttgaaactgggtggccgccggagcactgcttgcgctgcttcgctccaccggatgcccccttcgtcctgggcgccgccgcggccatccatctcggcaacaccaactcctgcatcgccggctacgacgacgacgacgctcccctgggggccaagcgtagctactaccagttctgcatcccctcctgggtagccctcgcacacgacaatggcaccgtcatctccggcgaggccgctatgaaccgcgccgccctcagcccctccacagctgtctccgccttcatgcgcctcctacacagaaggcaattcccccttccctcccctaaattcgttcttggtttgccagaccaattggggtagtttgtactagtaacaaacatcaaccggttattaatttgctgtgcgtgcccaattttgttaatcagggtggaggacgatgtggtgaagagagagatagagcttgtgccgtacaagtttaccaagatgctgggatgggtctccgtccaactagacacagatgctgaattctctgtcgaccatctcgccggcatcctcatctcccacctcaagcacacggcggaggcgcacctgggccgccacatcaacaatgctgtcatcaccctacccagtcgactcagctactccgccgatggcaggcaggtcctcagctcggcggcgaaggagtacagcggcttcagggccgtcaaggtcgtcgacgagcacatcgcggcggccgcggcgtatgggcaccacaccaagcagggtgaccgcaaggccatccttgtcttccatctcggcggccgcacctcccacgcaaccatcttcaagttcgtcgacggcacggctcgcctcatcgcgacgcgagctcatcatttcctcggaggcaagatcgatcaatgccctgcttctttcttaaatactagtacaaccaattaatttttctttcttttttttttgacatataatgtaggtgacgatttcacggcgaggatcgtggaccacatggtggagcacatcaaggagcagcatggcagggacgtacggcaggaggagaaggcaatggtgaggctaagggtggcgtgcgagcacgccaagaaggcactgagcgagcaacaagagaccctggtgcagatggactcgcttctggacgacggcgcggtcttctccgcgacgctgacgcgggccaagttcgaggagctcaaccacgacctgttggacagagccatggcgctggtgaaggaggtggtggtgacgacgggaggagtggaggtggtggacgaggttcttgtcgtcggcggcagcgcgaggattcccaaggttcgtcagctcgtcaaggactacttcaatggcaacggcaatggcacgcacccaaacagtcgcggttgcaaggggccggtggatgtggaaccagaggatgccgtgcttcatggcgccgcgcttctttcccgtcctctacctgttgcagagggaacagcagcagctcggtccatcggttccgtcggaggcatctgatctctctcgtgtagcttatgctttggctacgacgatgaaccaaggtgggtgcgcttcaggttggagcttacagtgagtgtgggtcattcttgccttctggagtcgttttactagttgtaacatgtagcactaaccactaaataattgttcatttccctgtgaaattctgaatgagacacctccttttgtcaagtc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063661.1 RefSeq:Os06g0212900]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
part of a killer-protector system was found at the S5 locus. ORF3(Os06g0212900) act as the protector to prevent ER stress and produce normal gametes.
Annotated Information
Function
Schematic representation of the killer-protector system in an indica-japonica hybrid regulated by the S5 locus.[1]
A killer-protector system was found at the S5 locus encoded by three tightly linked genes [Open Reading Frame 3 (ORF3)to ORF5] regulates fertility in indica japonica hybrids. During female sporogenesis, the action of ORF5+ (killer) and ORF4+ (partner) causes endoplasmic reticulum (ER) stress. ORF3+ (protector) prevents ER stress and produces normal gametes, but ORF3–cannot prevent ER stress, resulting in premature programmed cell death and leads to embryo-sac abortion. Preferential transmission ofORF3+ gametes results in segregation distortion in the progeny. These results add to our understanding of differences betweenindica andjaponica rice and may aid in rice genetic improvement.[1]
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
- National Key Laboratory of Crop Genetic Improvement and National Centre of Plant Gene Research, Huazhong Agricultural University, Wuhan 430070, China.
- School of Life Sciences, Chinese University of Hong Kong, Shatin, New Territories, Hong Kong 999077, China.
References
- ↑ 1.0 1.1 Jiangyi Yang, Xiaobo Zhao, Ke Cheng, Hongyi Du, Yidan Ouyang, Jiongjiong Chen, Shuqing Qiu, Jianyan Huang, Yunhe Jiang, Liwen Jiang, Jihua Ding, Jia Wang, Caiguo Xu, Xianghua Li, Qifa Zhang. (2012) A Killer-Protector System Regulates Both Hybrid Sterility and Segregation Distortion in Rice. Science 337: 1336-1340.
Structured Information