Difference between revisions of "Os08g0566600"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Phenotypic analysis)
 
(9 intermediate revisions by 4 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os08g0566600''''' was reported as '''''PGR5''''' in 2012 <ref name="ref1" /> by researchers from Japan.  
 
 
The rice Os08g0566600 was report as proton gradient regulation 5 ,which is is screened from the Rice Data.
 
 
 
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os08g0566600''''' '''<=>''' '''''OsPGR5,PGR5'''''
 
===Function===
 
===Function===
PGR5(PROTON GRADIENT REGULATION 5)gene is required for Rice photosystem I(PSI) cyclic electron transpor.The fucntions of PGR5 as follow:
+
* The '''''PGR5''''' (PROTON GRADIENT REGULATION 5) in Arabidopsis is required for PSI cyclic electron transport.
 
+
* The rice '''''PGR5''''' is required for ferredoxin (Fd)-dependent plastoquinone (PQ) reduction in ruptured chloroplasts of rice.
1.Cyclic electron transfer,which is depending on PGR5,helps to restore the balance of the oxidation of chloroplasts.
+
===Phenotypic analysis===
 
+
* In three '''''PGR5''''' knockdown (KD) lines, the PGR5 protein level was reduced to 5–8% of that in the wild type, resulting in a 50% reduction in PGRL1 (PGR5-LIKE PHOTOSYNTHETIC PHENOTYPE 1) protein levels.
2.PGR5 plays an key role in maintaining reduction capability the iron oxide-dependent protein bodies quinone when the rice chloroplast damage.
+
* In ruptured chloroplasts, ferredoxin-dependent plastoquinone reduction activity was partially impaired; the phenotype was mimicked by addition of antimycin A to wild-type chloroplasts.  
 
+
* As occurred in the Arabidopsis pgr5 mutant, non-photochemical quenching of Chl fluorescence (NPQ) induction was impaired in the leaves, but the electron transport rate (ETR) was only mildly affected at high light intensity.
===Expression===
+
* The P700+ level was reduced even at low light intensity, suggesting that the PGR5 function was severely disturbed as in the Arabidopsis pgr5 mutant and that the other alternative routes of electrons could not compensate the stromal redox balance.  
Please input expression information here.
+
* The amplitude of the light–dark electrochromic shift (ECS) signal (ECSt), which reflects the total size of the proton motive force in steady-state photosynthesis, was reduced by 13–25% at approximately the growth light intensity.  
 
+
* The CO2 fixation rate was only slightly reduced in the '''''PGR5''''' KD lines. Despite the drastic reduction in NPQ and P700+ levels, total biomass was only slightly reduced in '''''PGR5''''' KD lines grown at 370 mmol photons m–2s–1.
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
1.Department of Botany, Graduate School of Science, Kyoto University, Sakyo-ku, Kyoto, 606-8502 Japan
+
* Department of Botany, Graduate School of Science, Kyoto University, Sakyo-ku, Kyoto, 606-8502 Japan
 +
* CREST, Japan Science and Technology Agency, Chiyoda-ku, Tokyo, 102-0076 Japan
 +
* Department of Applied Plant Science, Graduate School of Agricultural Science, Tohoku University, Sendai, 981-8555 Japan
 +
* National Institute of Agrobiological Sciences, Tsukuba, Ibaraki, 305-8602 Japan
  
2.CREST, Japan Science and Technology Agency, Chiyoda-ku, Tokyo, 102-0076 Japan
+
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Nishikawa Y, Yamamoto H, Okegawa Y, Wada S, Sato N, Taira Y, Sugimoto K,
 +
Makino A, Shikanai T. PGR5-dependent cyclic electron transport around PSI
 +
contributes to the redox homeostasis in chloroplasts rather than CO(2) fixation
 +
and biomass production in rice. Plant Cell Physiol. 2012 Dec;53(12):2117-26. doi:
 +
10.1093/pcp/pcs153. PubMed PMID: 23161858.
 +
</ref>
  
3.Department of Applied Plant Science, Graduate School of Agricultural Science, Tohoku University, Sendai, 981-8555 Japan
+
</references>
 
 
4.National Institute of Agrobiological Sciences, Tsukuba, Ibaraki, 305-8602 Japan
 
 
 
==References==
 
1. PGR5-Dependent Cyclic Electron Transport Around PSI Contributes to the Redox Homeostasis in Chloroplasts Rather Than CO2 Fixation and Biomass Production in Rice Plant and Cell Physiology, 2012, 53(12): 2117-2126
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os08g0566600|
 
Description = Similar to PGR5|
 
Version = NM_001069077.1 GI:115477892 GeneID:4346358|
 
Length = 1075 bp|
 
Definition = Oryza sativa Japonica Group Os08g0566600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 8|Chromosome 8]]|
 
AP = Chromosome 8:28465852..28466926|
 
CDS = 28465967..28466239,28466430..28466534|
 
GCID = <gbrowseImage1>
 
name=NC_008401:28465852..28466926
 
source=RiceChromosome08
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008401:28465852..28466926
 
source=RiceChromosome08
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcagcagctgcagcatcatccgtgtccctccccggggcgagggctctcccgacgtggtccagctccgtgtccggcgactcgcactcgttggcgctgagctcgtgggcggcgcggcctcggtcggcgcggccactgcgggcgccggcgaggatgggcaacgtgaacgagggcaaggggatcttcgcaccggtggtggtggtggtgcgcaacatcgttggccgcaagcgcttcaaccagctcaggggaaaggccatcgcgctgcactcgcaggtgatcaccgagttctgcaagaccatcggcgccgacgccaagcagaggcagggcttgatccgccttgccaagaagaacggcgagaagctcggtttccttgcctga</cdnaseq>|
 
AA = <aaseq>MAAAAASSVSLPGARALPTWSSSVSGDSHSLALSSWAARPRSAR                    PLRAPARMGNVNEGKGIFAPVVVVVRNIVGRKRFNQLRGKAIALHSQVITEFCKTIGA                    DAKQRQGLIRLAKKNGEKLGFLA</aaseq>|
 
DNA = <dnaseqindica>116..388#579..683#actccactccacccaccggattgctaacttgcttcctccgtccgcggccaccactttctcctctcctcctcagagcaagatcattcaagtataatcctgcctcctactagctataatggcagcagctgcagcatcatccgtgtccctccccggggcgagggctctcccgacgtggtccagctccgtgtccggcgactcgcactcgttggcgctgagctcgtgggcggcgcggcctcggtcggcgcggccactgcgggcgccggcgaggatgggcaacgtgaacgagggcaaggggatcttcgcaccggtggtggtggtggtgcgcaacatcgttggccgcaagcgcttcaaccagctcaggggaaaggccatcgcgctgcactcgcaggtacgcacgtctactctactccgatcctcatcaattatagtacactagttttaattaattagctatcatcatctgccatgccatatatataagcaaattttgcaatcaaacatatcaatatgcttgctatctatcttgtgagtgagtgacttgtggccatcgatgatacggacggtactgcttgttgcaggtgatcaccgagttctgcaagaccatcggcgccgacgccaagcagaggcagggcttgatccgccttgccaagaagaacggcgagaagctcggtttccttgcctgatcgacatgcccttcctaattcctactagctcatttgattggtgtggatttcctctctgaatgaatgaatttcctgtagctagctagccagccgcgccttcctccctgcgtataaatgtgtcttgtgcgtacgtatacctcctcttctgaccttcaattccatccatccatgccatggcggcatgaacgaatgaattagtagtaagtaatacgcgcatgcatgaacgaatgaataatatactatataatgcgtgtatacagacactagcgctggctagcatgtatgatgatcatgatgtatatgtatgagactgagactgtatgtagccagttaagcgacatcattgccgtcaagctccaatcggatggatctggatctcctagtcaatcttt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069077.1 RefSeq:Os08g0566600]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 12:49, 28 October 2016

The rice Os08g0566600 was reported as PGR5 in 2012 [1] by researchers from Japan.

Annotated Information

Gene Symbol

  • Os08g0566600 <=> OsPGR5,PGR5

Function

  • The PGR5 (PROTON GRADIENT REGULATION 5) in Arabidopsis is required for PSI cyclic electron transport.
  • The rice PGR5 is required for ferredoxin (Fd)-dependent plastoquinone (PQ) reduction in ruptured chloroplasts of rice.

Phenotypic analysis

  • In three PGR5 knockdown (KD) lines, the PGR5 protein level was reduced to 5–8% of that in the wild type, resulting in a 50% reduction in PGRL1 (PGR5-LIKE PHOTOSYNTHETIC PHENOTYPE 1) protein levels.
  • In ruptured chloroplasts, ferredoxin-dependent plastoquinone reduction activity was partially impaired; the phenotype was mimicked by addition of antimycin A to wild-type chloroplasts.
  • As occurred in the Arabidopsis pgr5 mutant, non-photochemical quenching of Chl fluorescence (NPQ) induction was impaired in the leaves, but the electron transport rate (ETR) was only mildly affected at high light intensity.
  • The P700+ level was reduced even at low light intensity, suggesting that the PGR5 function was severely disturbed as in the Arabidopsis pgr5 mutant and that the other alternative routes of electrons could not compensate the stromal redox balance.
  • The amplitude of the light–dark electrochromic shift (ECS) signal (ECSt), which reflects the total size of the proton motive force in steady-state photosynthesis, was reduced by 13–25% at approximately the growth light intensity.
  • The CO2 fixation rate was only slightly reduced in the PGR5 KD lines. Despite the drastic reduction in NPQ and P700+ levels, total biomass was only slightly reduced in PGR5 KD lines grown at 370 mmol photons m–2s–1.

Labs working on this gene

  • Department of Botany, Graduate School of Science, Kyoto University, Sakyo-ku, Kyoto, 606-8502 Japan
  • CREST, Japan Science and Technology Agency, Chiyoda-ku, Tokyo, 102-0076 Japan
  • Department of Applied Plant Science, Graduate School of Agricultural Science, Tohoku University, Sendai, 981-8555 Japan
  • National Institute of Agrobiological Sciences, Tsukuba, Ibaraki, 305-8602 Japan

References

  1. Nishikawa Y, Yamamoto H, Okegawa Y, Wada S, Sato N, Taira Y, Sugimoto K, Makino A, Shikanai T. PGR5-dependent cyclic electron transport around PSI contributes to the redox homeostasis in chloroplasts rather than CO(2) fixation and biomass production in rice. Plant Cell Physiol. 2012 Dec;53(12):2117-26. doi: 10.1093/pcp/pcs153. PubMed PMID: 23161858.

Structured Information