Difference between revisions of "Os06g0266800"

From RiceWiki
Jump to: navigation, search
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''Os06g0266800''' was reported as '''OsGSR1''' in 2005 <ref name="ref1" /> by researchers from the USA.  
 +
<br>
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''Os06g0266800 <=> OsGSR1'''
 +
<br>
 
===Function===
 
===Function===
Please input function information here.
+
*'''OsGSR1''', a member of the GAST (GA-stimulated transcript) gene family, is induced by GA and repressed by BR.
 
+
*'''OsGSR1''' activates BR synthesis by directly regulating a BR biosynthetic enzyme at the post-translational level.  
===Expression===
+
<br>
Please input expression information here.
+
===Mutant===
 
+
*RNA interference (RNAi) transgenic rice plants with reduced OsGSR1 expression show phenotypes similar to plants deficient in BR, including short primary roots, erect leaves and reduced fertility.The OsGSR1 RNAi transgenic rice shows a reduced level of endogenous BR, and the dwarf phenotype could be rescued by the application of brassinolide.  
===Evolution===
+
<br>
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
 
 
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Research Center for Molecular & Developmental Biology, Key Laboratory of Photosynthesis and Environmental Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, Beijing 100093, China,
 +
*Department of Plant Biology, Carnegie Institution, Stanford, CA 94305, USA,
 +
*Department of Life Science, Chung-Ang University, Seoul 156 756, Korea,
 +
*National Plant Gene Research Center, Beijing 100093, China, and
 +
*Graduate School of the Chinese Academy of Sciences, Beijing 100049, China
 +
==References==
 +
<references>
 +
<ref name="ref1">
 +
OsGSR1 is involved in crosstalk between gibberellins and brassinosteroids in rice
 +
</ref>
  
==References==
+
</references>
Please input cited references here.
+
<br>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 6]]
GeneName = Os06g0266800|
 
Description = Similar to GAST1 protein precursor|
 
Version = NM_001063881.1 GI:115467493 GeneID:4340712|
 
Length = 433 bp|
 
Definition = Oryza sativa Japonica Group Os06g0266800, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
 
AP = Chromosome 6:8847298..8847730|
 
CDS = 8847374..8847628|
 
GCID = <gbrowseImage1>
 
name=NC_008399:8847298..8847730
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008399:8847298..8847730
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcaggagggcgcgggcgcggcggcggcggcggcggaggggtggccggcggcgggaacctgaggccgtgggagtgctcgcccaagtgcgcggggaggtgctccaacacgcagtacaagaaggcgtgcctgacgttctgcaacaagtgctgcgccaagtgcctgtgcgtgccgcccggcacctacggcaacaagggcgcctgcccctgctacaacaactggaagaccaaggaaggcggccccaagtgcccctaa</cdnaseq>|
 
AA = <aaseq>MAGGRGRGGGGGGGVAGGGNLRPWECSPKCAGRCSNTQYKKACL                    TFCNKCCAKCLCVPPGTYGNKGACPCYNNWKTKEGGPKCP</aaseq>|
 
DNA = <dnaseqindica>103..357#acaatctctctaacctctccttcaacctgattactatatatcttgaatcttgggttaatcttgacgttcttgttcgttcttgtttctcgcgtgcaggaggtgatggcaggagggcgcgggcgcggcggcggcggcggcggaggggtggccggcggcgggaacctgaggccgtgggagtgctcgcccaagtgcgcggggaggtgctccaacacgcagtacaagaaggcgtgcctgacgttctgcaacaagtgctgcgccaagtgcctgtgcgtgccgcccggcacctacggcaacaagggcgcctgcccctgctacaacaactggaagaccaaggaaggcggccccaagtgcccctaagatgcatgcctttttttctttcttcttttttttttgtttttttaccgtatgattaatacctcctactagttctact</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063881.1 RefSeq:Os06g0266800]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 6]]
 
[[Category:Chromosome 6]]
 

Latest revision as of 09:13, 7 November 2016

The rice Os06g0266800 was reported as OsGSR1 in 2005 [1] by researchers from the USA.

Annotated Information

Gene Symbol

  • Os06g0266800 <=> OsGSR1


Function

  • OsGSR1, a member of the GAST (GA-stimulated transcript) gene family, is induced by GA and repressed by BR.
  • OsGSR1 activates BR synthesis by directly regulating a BR biosynthetic enzyme at the post-translational level.


Mutant

  • RNA interference (RNAi) transgenic rice plants with reduced OsGSR1 expression show phenotypes similar to plants deficient in BR, including short primary roots, erect leaves and reduced fertility.The OsGSR1 RNAi transgenic rice shows a reduced level of endogenous BR, and the dwarf phenotype could be rescued by the application of brassinolide.


Labs working on this gene

  • Research Center for Molecular & Developmental Biology, Key Laboratory of Photosynthesis and Environmental Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, Beijing 100093, China,
  • Department of Plant Biology, Carnegie Institution, Stanford, CA 94305, USA,
  • Department of Life Science, Chung-Ang University, Seoul 156 756, Korea,
  • National Plant Gene Research Center, Beijing 100093, China, and
  • Graduate School of the Chinese Academy of Sciences, Beijing 100049, China

References

  1. OsGSR1 is involved in crosstalk between gibberellins and brassinosteroids in rice


Structured Information