Difference between revisions of "Os12g0152500"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os12g0152500| Description = Hypothetical protein| Version = NM_001072707.1 GI:115487375 GeneID:4351523| Length = 893 bp| Definition = Oryza sat...")
 
(Annotated Information)
 
(3 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os12g0152500''''' was reported as '''''MIL2''''' in 2012 <ref name="ref1" /> by researchers from China.  
GeneName = Os12g0152500|
 
Description = Hypothetical protein|
 
Version = NM_001072707.1 GI:115487375 GeneID:4351523|
 
Length = 893 bp|
 
Definition = Oryza sativa Japonica Group Os12g0152500, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
[[File:190-Os12g0152500.png|right|thumb|227px|'''Figure 1.''' ''Phenotypic analysis of the microsporeless2 (mil2) mutant.<ref name="ref1" />.'']]
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
===Function===
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
* '''''MIL2''''' encodes the rice homolog of the Arabidopsis TAPETUM DETERMINANT1 (TPD1) protein.
|
+
* '''''MICROSPORELESS2 (MIL2)''''' regulates early anther cell differentiation in rice.
Chromosome = [[:category:Japonica Chromosome 12|Chromosome 12]]|
+
* '''''MIL2''''' is responsible for the differentiation of primary parietal cells into secondary parietal cells in rice anthers, and suggest that rice and Arabidopsis anthers might share similar regulators in anther patterning, but divergent mechanisms are employed in these processes.
AP = Chromosome 12:2587463..2588355|
+
 
CDS = 2587463..2587644,2587888..2588052,2588142..2588355|
+
===Phenotypic analysis===
GCID = <gbrowseImage1>
+
* The anthers of '''''mil2''''' mutants were characterized using molecular markers and cytological examination. '''''mil2''''' anthers display phenotypes different from those of tpd1 mutants, with only two layers of anther wall cells formed.
name=NC_008405:2587463..2588355
+
 
source=RiceChromosome12
+
===Expression===
preset=GeneLocation
+
* '''''MIL2''''' has an expression pattern distinct from that of TPD1. Its transcripts and proteins predominate in inner parietal cells, but show little accumulation in reproductive cells.
</gbrowseImage1>|
+
 
GSID = <gbrowseImage2>
+
You can also add sub-section(s) at will.
name=NC_008405:2587463..2588355
+
 
source=RiceChromosome12
+
==Labs working on this gene==
preset=GeneLocation
+
* State Key Laboratory of Plant Genomics and Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, 100101, China;
</gbrowseImage2>|
+
* Biotechnology Research Institute/National Key Facility for Gene Resources and Gene Improvement, Chinese Academy of Agricultural Sciences, Beijing, 100081, China
CDNA = <cdnaseq>atggttccaaggattggcctgctggttgtgctggttggattggccttccaggcaattctccatccaccacctcaaaaattgtgtggctcaccaggtggacctcctgtgacatctcccaggatcaagctcagtgatagaaggcacgcctacaaagagggtggagttcaaaaagacaaggccaaagcagggtatggggaaaattatccaaatcccaagaggaatgtaaggagtgaggcattggatattgaggagctcactgaccagctcaagcttggacagaagttctgtgttgggaatgtcgatgggaggatacccaatttggggtgccttcagtatataccaaacaggcttgcaggagcagcgttagttctgcccattatcaactactggtggccttcttcccccgctgagctatccaggcaagccttcatgggtctcatcatgccagagcagaggacactctggattgcacacaacataaacttccttgctctacctctggatgacccagaagtggctcccttcttctgcggcagccatgcatcatcctgcaatatttag</cdnaseq>|
+
 
AA = <aaseq>MVPRIGLLVVLVGLAFQAILHPPPQKLCGSPGGPPVTSPRIKLS                    DRRHAYKEGGVQKDKAKAGYGENYPNPKRNVRSEALDIEELTDQLKLGQKFCVGNVDG                    RIPNLGCLQYIPNRLAGAALVLPIINYWWPSSPAELSRQAFMGLIMPEQRTLWIAHNI                    NFLALPLDDPEVAPFFCGSHASSCNI</aaseq>|
+
==References==
DNA = <dnaseqindica>1..182#426..590#680..893#atggttccaaggattggcctgctggttgtgctggttggattggccttccaggcaattctccatccaccacctcaaaaattgtgtggctcaccaggtggacctcctgtgacatctcccaggatcaagctcagtgatagaaggcacgcctacaaagagggtggagttcaaaaagacaaggccaagtagataatcgcagtgcatgcatttgatgaaaccaaggacttacccttgcctgtttctaaggtaaaggcaaacaacaaatacagtaagattggaaattcctctttttgtgtggatcaaatctacatagaattgcaacattgattttttttctttagttcacacttttcttaacacattactttgtctgtcaaaattcaggaacttgtggatgaactgggaatttaccttcttgctttcgacagagcagggtatggggaaaattatccaaatcccaagaggaatgtaaggagtgaggcattggatattgaggagctcactgaccagctcaagcttggacagaagttctgtgttgggaatgtcgatgggaggatacccaatttggggtgccttcagtatataccaaacaggtaaagaccgaaactgcaatactgtaccatcaatggtatatgtgacccttcactctccagaaatgtaaagatacaactactgtgtgcaggcttgcaggagcagcgttagttctgcccattatcaactactggtggccttcttcccccgctgagctatccaggcaagccttcatgggtctcatcatgccagagcagaggacactctggattgcacacaacataaacttccttgctctacctctggatgacccagaagtggctcccttcttctgcggcagccatgcatcatcctgcaatatttag</dnaseqindica>|
+
<references>
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072707.1 RefSeq:Os12g0152500]|
+
* <ref name="ref1">
}}
+
Hong L, Tang D, Shen Y, et al. MIL2 (MICROSPORELESS2) regulates early cell differentiation in the rice anther.[J]. New Phytologist, 2012, 196(2):402-13.
[[Category:Genes]]
+
</ref>
[[Category:Japonica mRNA]]
+
</references>
[[Category:Oryza Sativa Japonica Group]]
+
 
[[Category:Japonica Genes]]
+
==Structured Information==
[[Category:Japonica Chromosome 12]]
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 12]]
[[Category:Chromosome 12]]
 

Latest revision as of 04:59, 9 November 2016

The rice Os12g0152500 was reported as MIL2 in 2012 [1] by researchers from China.

Annotated Information

Figure 1. Phenotypic analysis of the microsporeless2 (mil2) mutant.[1].

Function

  • MIL2 encodes the rice homolog of the Arabidopsis TAPETUM DETERMINANT1 (TPD1) protein.
  • MICROSPORELESS2 (MIL2) regulates early anther cell differentiation in rice.
  • MIL2 is responsible for the differentiation of primary parietal cells into secondary parietal cells in rice anthers, and suggest that rice and Arabidopsis anthers might share similar regulators in anther patterning, but divergent mechanisms are employed in these processes.

Phenotypic analysis

  • The anthers of mil2 mutants were characterized using molecular markers and cytological examination. mil2 anthers display phenotypes different from those of tpd1 mutants, with only two layers of anther wall cells formed.

Expression

  • MIL2 has an expression pattern distinct from that of TPD1. Its transcripts and proteins predominate in inner parietal cells, but show little accumulation in reproductive cells.

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Plant Genomics and Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, 100101, China;
  • Biotechnology Research Institute/National Key Facility for Gene Resources and Gene Improvement, Chinese Academy of Agricultural Sciences, Beijing, 100081, China

References

  1. 1.0 1.1 Hong L, Tang D, Shen Y, et al. MIL2 (MICROSPORELESS2) regulates early cell differentiation in the rice anther.[J]. New Phytologist, 2012, 196(2):402-13.

Structured Information