Difference between revisions of "Os02g0765600"

From RiceWiki
Jump to: navigation, search
(References)
 
(6 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os02g0765600''''' was reported as '''''Amy1A''''' in 2012 <ref name="ref1" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:Os02g0765600.png|right|thumb|427px|'''Figure 1.''' ''a-Amylase activity and expression levels of eight a-amylase genes during grain filling.<ref name="ref1" />.'']]
 +
===Gene Symbol===
 +
*'''''Os02g0765600''''' '''''<=>''''' '''''OsAmy1A''''','''''Amy1A'''''
 
===Function===
 
===Function===
Alpha-amylase gene, RAmylA, encodes rice α-amylase isoform A.
+
* '''''Amy1A''''' is a member of α-Amylase (EC3.2.1.1) gene family, which encodes a starch-hydrolyzing enzyme.
 +
* Activation of α-amylase by high temperature is a crucial trigger for grain chalkiness and that its suppression is a potential strategy for ameliorating grain damage from global warming
 +
* α-amylase is one of the enzymes involved in the first committed step for degradation of reserve starch. During the process, synthesis of a-amylase is up-regulated by a plant hormone, gibberellin (GA), but down-regulated by another hormone, abscisic acid (ABA), and by sugars.
  
 
===Expression===
 
===Expression===
A significant difference in the seed germinability was observed between the two rice cultivars, 'Nipponbare' and 'Suweon 287', under anoxia (i.e., during germination in submerged soil at 18℃), although little difference was seen under aerobic (in air) or hypoxic (in water) conditions. The number of α-amylase isoforms synthesized in germinating seeds was inversely proportional to the O2 concentrations at the early germination stage. The formation of isoform B was promoted by oxygen supply, while isoform H was undetectable if the seeds were unable to germinate. The activity of isoform H was highly correlated with the coleoptile length in the submerged soil at 18℃, indicating that isoform H is a critical factor for seed germination under anoxia. The expression of the rice α-amylase RAmy1A gene was repressed when the seeds germinated under hypoxia or anoxia[1]. Northern blot analysis and RNA-PCR were used to detect the expression of α-amylase genes in various tissues. Alpha-amylase mRNA was abundant in germinating seeds and callus. RAmy1A and RAmy3E were expressed in all tissues and RAmy1A transcript was most abundant in the germinating seeds[2]. And RAmy1A was demonstrated to be sugar tepressed in rice embryos and functional dissection of the promoter of RAmy1A in relation of its sugar-modulated expression was performed[3].
+
* A series of quantitative real-time RT-PCR analyses using gene-specific primer sets for respective a-amylase genes revealed that the expression of '''''Amy1C''''' and '''''Amy3A''''' as well as '''''Amy1A''''', '''''Amy3D''''' and '''''Amy3E''''' was up-regulated under high temperature (33 °C/28 °C) in the middle of the ripening stage at around 15 days after flowering (DAF; Figure 1b).  
 +
* '''''Amy1A''''' and '''''Amy1C''''' showed a similar pattern of expression in the high temperature plot, gradually increasing from 8 DAF and peaking at 15–20 DAF. '''''Amy3A''''' and '''''Amy3D''''' expression peaked around 15 DAF, while '''''Amy3E''''' showed high levels at 8–30 DAF in the high temperature plot. In contrast, the expression of '''''Amy2A''''', '''''Amy3B''''' and '''''Amy3C''''' was not induced by high temperature (Figure 1b).  
 +
* The intensity of the expression of all a-amylase genes in the course of grain filling clearly indicates that the newly characterized '''''Amy3A''''' gene was expressed at a considerable level under high temperature from 15 DA.
  
===Ontology===
+
==Labs working on this gene==
Gene ontology: The chemical reactions and pathways involve in carbohydrates.
+
* National Agricultural Research Center, Joetsu, Japan
----
+
* RIKEN Plant Science Center, Tsurumi, Yokohama, Japan
Growth stage ontology: It occurs when the seed coat has imbibed adequate water becoming soft and elastic.
+
* Niigata University, Ikarashi, Niigata, Japan
  
==Labs working on this gene==
+
You can also add sub-section(s) at will.
(1) Graduate School of Agricultural and Life Sciences, The University of Tokyo, Tokyo 113-8657, Japan
 
----
 
(2) Bioscience Center and Graduate School of Bioagricultural Sciences, Nagoya University, Chikusa-ku, Nagoya 464-8601, Japan
 
----
 
(3)Department of Genetics, University of California Davis, CA 95616, USA
 
----
 
(4)Bioscience Center, Nagoya University, Chikusa-ku, Nagoya 464-8601, Japan
 
----
 
(5)Department of Agriculture, Meijo University, Tenpaku-ku, Nagoya 468, Japan
 
----
 
(6)Department of Crop Plant Biology, University of Pisa, Via Mariscoglio 34, 56124 Pisa, Italy.
 
  
 
==References==
 
==References==
1. Jirong Huang;Kyoko Toyofuku;Junji Yamaguchi;Shigemi Akita, Expression of α-amylase isoforms and the RAmy1A gene in rice (Oryza sativa L.) during seed germination, and its relationship with coleoptile length in submerged soil, Plant production science, 2000, 3(1): 32-37
+
<references>
----
+
* <ref name="ref1">
2.Ning Huang;Nozomu Koizumi;Stephen Reinl;Raymond L. Rodriguez, Structural organization and differential expression of rice α-amylase genes, Nucleic Acids Research, 1990, 18(23): 7007-7014
+
Hakata M, Kuroda M, Miyashita T, et al. Suppression of α-amylase genes improves quality of rice grain ripened under high temperature.[J]. Plant Biotechnology Journal, 2012, 10(9):1110–1117.
----
+
</ref>
3.  Akiyoshi Morita;Taka-aki Umemura;Mitsuyo Kuroyanagi;Yuzo Futsuhara;Pierdomenico Perata;Junji Yamaguchi, Functional dissection of a sugar-repressed α-amylase gene (RAmy1A) promoter in rice embryos, FEBS Letters, 1998, 423(1): 81-85
+
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
GeneName = Os02g0765600|
 
Description = Alpha-amylase precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase) (Isozyme 1B)|
 
Version = NM_001054755.1 GI:115448880 GeneID:4330832|
 
Length = 1846 bp|
 
Definition = Oryza sativa Japonica Group Os02g0765600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:33135190..33137035|
 
CDS = 33135415..33135666,33135751..33136562,33136657..33136789,33136898..33137005|
 
GCID = <gbrowseImage1>
 
name=NC_008395:33135190..33137035
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:33135190..33137035
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgcaggtgctgaacaccatggtgaacaaacacttcttgtccctttcggtcctcatcgtcctccttggcctctcctccaacttgacagccgggcaagtcctgtttcagggattcaactgggagtcgtggaaggagaatggcgggtggtacaacttcctgatgggcaaggtggacgacatcgccgcagccggcatcacccacgtctggctccctccgccgtctcactctgtcggcgagcaaggctacatgcctgggcggctgtacgatctggacgcgtctaagtacggcaacgaggcgcagctcaagtcgctgatcgaggcgttccatggcaagggcgtccaggtgatcgccgacatcgtcatcaaccaccgcacggcggagcacaaggacggccgcggcatctactgcctcttcgagggcgggacgcccgactcccgcctcgactggggcccgcacatgatctgccgcgacgacccctacggcgatggcaccggcaacccggacaccggcgccgacttcgccgccgcgccggacatcgaccacctcaacaagcgcgtccagcgggagctcattggctggctcgactggctcaagatggacatcggcttcgacgcgtggcgcctcgacttcgccaagggctactccgccgacatggcaaagatctacatcgacgccaccgagccgagcttcgccgtggccgagatatggacgtccatggcgaacggcggggacggcaagccgaactacgaccagaacgcgcaccggcaggagctggtcaactgggtcgatcgtgtcggcggcgccaacagcaacgccacggcgttcgacttcaccaccaagggcatcctcaacgtcgccgtggagggcgagctgtggcgcctccgcggcgaggacggcaaggcgcccggcatgatcgggtggtggccggccaaggcgacgaccttcgtcgacaaccacgacaccggctcgacgcagcacctgtggccgttcccctccgacaaggtcatgcagggctacgcatacatcctcacccaccccggcaacccatgcatcttctacgaccatttcttcgattggggtctcaaggaggagatcgagcgcctggtgtcaatcagaaaccggcaggggatccacccggcgagcgagctgcgcatcatggaagctgacagcgatctctacctcgcggagatcgatggcaaggtgatcacaaagattggaccaagatacgacgtcgaacacctcatccccgaaggcttccaggtcgtcgcgcacggtgatggctacgcaatctgggagaaaatctga</cdnaseq>|
 
AA = <aaseq>MQVLNTMVNKHFLSLSVLIVLLGLSSNLTAGQVLFQGFNWESWK                    ENGGWYNFLMGKVDDIAAAGITHVWLPPPSHSVGEQGYMPGRLYDLDASKYGNEAQLK                    SLIEAFHGKGVQVIADIVINHRTAEHKDGRGIYCLFEGGTPDSRLDWGPHMICRDDPY                    GDGTGNPDTGADFAAAPDIDHLNKRVQRELIGWLDWLKMDIGFDAWRLDFAKGYSADM                    AKIYIDATEPSFAVAEIWTSMANGGDGKPNYDQNAHRQELVNWVDRVGGANSNATAFD                    FTTKGILNVAVEGELWRLRGEDGKAPGMIGWWPAKATTFVDNHDTGSTQHLWPFPSDK                    VMQGYAYILTHPGNPCIFYDHFFDWGLKEEIERLVSIRNRQGIHPASELRIMEADSDL                    YLAEIDGKVITKIGPRYDVEHLIPEGFQVVAHGDGYAIWEKI</aaseq>|
 
DNA = <dnaseqindica>1370..1621#474..1285#247..379#31..138#aatcatccatctccgaagtgtgtctgcagcatgcaggtgctgaacaccatggtgaacaaacacttcttgtccctttcggtcctcatcgtcctccttggcctctcctccaacttgacagccgggcaagtcctgtttcaggtaagagatcgccatgagttgggtttcaggcttcagtgaactgatcgggttttgtactgagcctaagagaatgatgcagtgatgctcttgtgtttgatgatgatgcagggattcaactgggagtcgtggaaggagaatggcgggtggtacaacttcctgatgggcaaggtggacgacatcgccgcagccggcatcacccacgtctggctccctccgccgtctcactctgtcggcgagcaaggtgcggtgctctgctctctcgatcccctccgtcgtcgcaccattgccggcaaaatacatgcacaggtcgttgaattgcttgaatgcttctgcaggctacatgcctgggcggctgtacgatctggacgcgtctaagtacggcaacgaggcgcagctcaagtcgctgatcgaggcgttccatggcaagggcgtccaggtgatcgccgacatcgtcatcaaccaccgcacggcggagcacaaggacggccgcggcatctactgcctcttcgagggcgggacgcccgactcccgcctcgactggggcccgcacatgatctgccgcgacgacccctacggcgatggcaccggcaacccggacaccggcgccgacttcgccgccgcgccggacatcgaccacctcaacaagcgcgtccagcgggagctcattggctggctcgactggctcaagatggacatcggcttcgacgcgtggcgcctcgacttcgccaagggctactccgccgacatggcaaagatctacatcgacgccaccgagccgagcttcgccgtggccgagatatggacgtccatggcgaacggcggggacggcaagccgaactacgaccagaacgcgcaccggcaggagctggtcaactgggtcgatcgtgtcggcggcgccaacagcaacgccacggcgttcgacttcaccaccaagggcatcctcaacgtcgccgtggagggcgagctgtggcgcctccgcggcgaggacggcaaggcgcccggcatgatcgggtggtggccggccaaggcgacgaccttcgtcgacaaccacgacaccggctcgacgcagcacctgtggccgttcccctccgacaaggtcatgcagggctacgcatacatcctcacccaccccggcaacccatgcatcgtgagtagccaactcgatcagaaattctgaatcatcctgcaaactgatcgatgaactgatgataaattctgtaaaattgttcagttctacgaccatttcttcgattggggtctcaaggaggagatcgagcgcctggtgtcaatcagaaaccggcaggggatccacccggcgagcgagctgcgcatcatggaagctgacagcgatctctacctcgcggagatcgatggcaaggtgatcacaaagattggaccaagatacgacgtcgaacacctcatccccgaaggcttccaggtcgtcgcgcacggtgatggctacgcaatctgggagaaaatctgagcgcacgatgacgagactctcagtttagcagatttaacctgcgatttttaccctgaccggtatacgtatatacgtgccggcaacgagctgtatccgatccgaattacggatgcaattgtccacgaagtacttcctccgtaaataaagtgaggatcagggacatacatttgtatggttttacgaataatgctatgcaataaaatttgcactgcttaatgcttatgc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054755.1 RefSeq:Os02g0765600]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 09:31, 9 November 2016

The rice Os02g0765600 was reported as Amy1A in 2012 [1] by researchers from Japan.

Annotated Information

Figure 1. a-Amylase activity and expression levels of eight a-amylase genes during grain filling.[1].

Gene Symbol

  • Os02g0765600 <=> OsAmy1A,Amy1A

Function

  • Amy1A is a member of α-Amylase (EC3.2.1.1) gene family, which encodes a starch-hydrolyzing enzyme.
  • Activation of α-amylase by high temperature is a crucial trigger for grain chalkiness and that its suppression is a potential strategy for ameliorating grain damage from global warming
  • α-amylase is one of the enzymes involved in the first committed step for degradation of reserve starch. During the process, synthesis of a-amylase is up-regulated by a plant hormone, gibberellin (GA), but down-regulated by another hormone, abscisic acid (ABA), and by sugars.

Expression

  • A series of quantitative real-time RT-PCR analyses using gene-specific primer sets for respective a-amylase genes revealed that the expression of Amy1C and Amy3A as well as Amy1A, Amy3D and Amy3E was up-regulated under high temperature (33 °C/28 °C) in the middle of the ripening stage at around 15 days after flowering (DAF; Figure 1b).
  • Amy1A and Amy1C showed a similar pattern of expression in the high temperature plot, gradually increasing from 8 DAF and peaking at 15–20 DAF. Amy3A and Amy3D expression peaked around 15 DAF, while Amy3E showed high levels at 8–30 DAF in the high temperature plot. In contrast, the expression of Amy2A, Amy3B and Amy3C was not induced by high temperature (Figure 1b).
  • The intensity of the expression of all a-amylase genes in the course of grain filling clearly indicates that the newly characterized Amy3A gene was expressed at a considerable level under high temperature from 15 DA.

Labs working on this gene

  • National Agricultural Research Center, Joetsu, Japan
  • RIKEN Plant Science Center, Tsurumi, Yokohama, Japan
  • Niigata University, Ikarashi, Niigata, Japan

You can also add sub-section(s) at will.

References

  1. 1.0 1.1 Hakata M, Kuroda M, Miyashita T, et al. Suppression of α-amylase genes improves quality of rice grain ripened under high temperature.[J]. Plant Biotechnology Journal, 2012, 10(9):1110–1117.

Structured Information