Difference between revisions of "Os09g0457800"

From RiceWiki
Jump to: navigation, search
 
(5 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os09g0457800''''' was reported as '''''Amy3C''''' in 2012 <ref name="ref1" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:Os02g0765600.png|right|thumb|427px|'''Figure 1.''' ''a-Amylase activity and expression levels of eight a-amylase genes during grain filling.<ref name="ref1" />.'']]
 +
===Gene Symbol===
 +
*'''''Os09g0457800''''' '''''<=>''''' '''''OsAmy3C''''','''''Amy3C'''''
 
===Function===
 
===Function===
Please input function information here.
+
* '''''Amy3C''''' is a member of α-Amylase (EC3.2.1.1) gene family, which encodes a starch-hydrolyzing enzyme.
 +
* Activation of a-amylase by high temperature is a crucial trigger for grain chalkiness and that its suppression is a potential strategy for ameliorating grain damage from global warming
 +
* α-amylase is one of the enzymes involved in the first committed step for degradation of reserve starch. During the process, synthesis of a-amylase is up-regulated by a plant hormone, gibberellin (GA), but down-regulated by another hormone, abscisic acid (ABA), and by sugars.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* A series of quantitative real-time RT-PCR analyses using gene-specific primer sets for respective a-amylase genes revealed that the expression of '''''Amy1C''''' and '''''Amy3A''''' as well as '''''Amy1A''''', '''''Amy3D''''' and '''''Amy3E''''' was up-regulated under high temperature (33 °C/28 °C) in the middle of the ripening stage at around 15 days after flowering (DAF; Figure 1b).  
 
+
* '''''Amy1A''''' and '''''Amy1C''''' showed a similar pattern of expression in the high temperature plot, gradually increasing from 8 DAF and peaking at 15–20 DAF. '''''Amy3A''''' and '''''Amy3D''''' expression peaked around 15 DAF, while '''''Amy3E''''' showed high levels at 8–30 DAF in the high temperature plot. In contrast, the expression of '''''Amy2A''''', '''''Amy3B''''' and '''''Amy3C''''' was not induced by high temperature (Figure 1b).
===Evolution===
+
* The intensity of the expression of all a-amylase genes in the course of grain filling clearly indicates that the newly characterized '''''Amy3A''''' gene was expressed at a considerable level under high temperature from 15 DA.
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* National Agricultural Research Center, Joetsu, Japan
 +
* RIKEN Plant Science Center, Tsurumi, Yokohama, Japan
 +
* Niigata University, Ikarashi, Niigata, Japan
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Hakata M, Kuroda M, Miyashita T, et al. Suppression of α-amylase genes improves quality of rice grain ripened under high temperature.[J]. Plant Biotechnology Journal, 2012, 10(9):1110–1117.
 +
</ref>
 +
</references>
 +
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 9]]
GeneName = Os09g0457800|
 
Description = Alpha-amylase isozyme 3C precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase)|
 
Version = NM_001069904.1 GI:115479550 GeneID:4347265|
 
Length = 1644 bp|
 
Definition = Oryza sativa Japonica Group Os09g0457800, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
 
AP = Chromosome 9:17957030..17958673|
 
CDS = 17957060..17957152,17957275..17958213,17958304..17958585|
 
GCID = <gbrowseImage1>
 
name=NC_008402:17957030..17958673
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008402:17957030..17958673
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcaaagcattccaccacaatgagctgcctcctattcttcgtcttgctctgtttgggctctcacttagcccaggctcaggttctctttcagggattcaactgggagtcatggaagaagcagggtgggtggtacaacttcctccatagccacgtcgacgacatcgccgcgaccggagtcacacacgtctggctcccgccgccgtcgcactccgtcgcgccacagggatacatgccgggacggctctacgacctggacgcgtccaagtacgggacgggggcagagctcaggtcgctgatcgccgccttccacagcaagagcatcaagtgcgtcgccgacatcgtcatcaaccaccggtgcgcggattacaaggatagccgtggcatctactgcatcttcgagggtggcacgccggacagccgcctcgactggggtcccgacatgatctgcagcgacgacacgcagtactccaacggccgcggtcaccgcgatactggcgcagacttcggcgcggcgcccgacatcgaccacctcaacacgcgtgtgcagacagagctctccgactggctcaactggctcaagtccgacgtcggcttcgacggctggcgcctcgacttcgccaagggatactcggcgaccgtcgccaagacgtacgtggacaacaccgacccgtccttcgtcgtcgccgagatatggagcaacatgcgttacgacggcaacggtgagccgtcgtggaaccaggacggtgaccggcaggagttggtgaactgggcgcaggccgtcggtggccctgcatcggcgttcgacttcacgaccaagggcgagctgcaggcagcggtgcaaggtgagctgtggcggatgaaggatggcaacggcaaggcgccggggatgattggctggctgccggagaaggctgtcaccttcatcgacaatcatgacactggctccacacagaactcatggccgttcccctccgacaaggtcatgcagggctacgcctacatcctcacacaccctggagtaccctgcattttctacgaccatgtgtttgactggaacttgaagcaggagatcagcacattggccgcggtgaggtcaagaaatggaattcatcctgggagcaagctgaacatccttgctgctgacggagatgtctacgtcgccatgatcgatgacaaggtgatcacaaagattgggactcggtatgatgtgggcaacttgatcccgtcagacttccatgtcgttgctcacggcaacaattactgcgtctgggaaaagagtggtcttagagttccagcagggcggcgccactag</cdnaseq>|
 
AA = <aaseq>MAKHSTTMSCLLFFVLLCLGSHLAQAQVLFQGFNWESWKKQGGW                    YNFLHSHVDDIAATGVTHVWLPPPSHSVAPQGYMPGRLYDLDASKYGTGAELRSLIAA                    FHSKSIKCVADIVINHRCADYKDSRGIYCIFEGGTPDSRLDWGPDMICSDDTQYSNGR                    GHRDTGADFGAAPDIDHLNTRVQTELSDWLNWLKSDVGFDGWRLDFAKGYSATVAKTY                    VDNTDPSFVVAEIWSNMRYDGNGEPSWNQDGDRQELVNWAQAVGGPASAFDFTTKGEL                    QAAVQGELWRMKDGNGKAPGMIGWLPEKAVTFIDNHDTGSTQNSWPFPSDKVMQGYAY                    ILTHPGVPCIFYDHVFDWNLKQEISTLAAVRSRNGIHPGSKLNILAADGDVYVAMIDD                    KVITKIGTRYDVGNLIPSDFHVVAHGNNYCVWEKSGLRVPAGRRH</aaseq>|
 
DNA = <dnaseqindica>31..123#246..1184#1275..1556#acacaactcagcttgtatctgagacacgcaatggcaaagcattccaccacaatgagctgcctcctattcttcgtcttgctctgtttgggctctcacttagcccaggctcaggttctctttcaggtgagtctcattgatcatttgatctgctgtacttcccgttagtatgtcacatgacaataggaaatagttcctagctatgaacaaatttgacgtacctgcacgttgacatgatgttggtgcagggattcaactgggagtcatggaagaagcagggtgggtggtacaacttcctccatagccacgtcgacgacatcgccgcgaccggagtcacacacgtctggctcccgccgccgtcgcactccgtcgcgccacagggatacatgccgggacggctctacgacctggacgcgtccaagtacgggacgggggcagagctcaggtcgctgatcgccgccttccacagcaagagcatcaagtgcgtcgccgacatcgtcatcaaccaccggtgcgcggattacaaggatagccgtggcatctactgcatcttcgagggtggcacgccggacagccgcctcgactggggtcccgacatgatctgcagcgacgacacgcagtactccaacggccgcggtcaccgcgatactggcgcagacttcggcgcggcgcccgacatcgaccacctcaacacgcgtgtgcagacagagctctccgactggctcaactggctcaagtccgacgtcggcttcgacggctggcgcctcgacttcgccaagggatactcggcgaccgtcgccaagacgtacgtggacaacaccgacccgtccttcgtcgtcgccgagatatggagcaacatgcgttacgacggcaacggtgagccgtcgtggaaccaggacggtgaccggcaggagttggtgaactgggcgcaggccgtcggtggccctgcatcggcgttcgacttcacgaccaagggcgagctgcaggcagcggtgcaaggtgagctgtggcggatgaaggatggcaacggcaaggcgccggggatgattggctggctgccggagaaggctgtcaccttcatcgacaatcatgacactggctccacacagaactcatggccgttcccctccgacaaggtcatgcagggctacgcctacatcctcacacaccctggagtaccctgcattgtgagtgctcagcttgataatctccatcgctatcagaaatcgatatttgttaaccataatctcgaactaacattccgtctgtctgtacagttctacgaccatgtgtttgactggaacttgaagcaggagatcagcacattggccgcggtgaggtcaagaaatggaattcatcctgggagcaagctgaacatccttgctgctgacggagatgtctacgtcgccatgatcgatgacaaggtgatcacaaagattgggactcggtatgatgtgggcaacttgatcccgtcagacttccatgtcgttgctcacggcaacaattactgcgtctgggaaaagagtggtcttagagttccagcagggcggcgccactaggccaaatatttctttcaggactattttgtgcctgaaataagaagtttaaatgatgtcttaaataacaagaaagtgattgattgattgt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069904.1 RefSeq:Os09g0457800]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 9]]
 
[[Category:Chromosome 9]]
 

Latest revision as of 09:32, 9 November 2016

The rice Os09g0457800 was reported as Amy3C in 2012 [1] by researchers from Japan.

Annotated Information

Figure 1. a-Amylase activity and expression levels of eight a-amylase genes during grain filling.[1].

Gene Symbol

  • Os09g0457800 <=> OsAmy3C,Amy3C

Function

  • Amy3C is a member of α-Amylase (EC3.2.1.1) gene family, which encodes a starch-hydrolyzing enzyme.
  • Activation of a-amylase by high temperature is a crucial trigger for grain chalkiness and that its suppression is a potential strategy for ameliorating grain damage from global warming
  • α-amylase is one of the enzymes involved in the first committed step for degradation of reserve starch. During the process, synthesis of a-amylase is up-regulated by a plant hormone, gibberellin (GA), but down-regulated by another hormone, abscisic acid (ABA), and by sugars.

Expression

  • A series of quantitative real-time RT-PCR analyses using gene-specific primer sets for respective a-amylase genes revealed that the expression of Amy1C and Amy3A as well as Amy1A, Amy3D and Amy3E was up-regulated under high temperature (33 °C/28 °C) in the middle of the ripening stage at around 15 days after flowering (DAF; Figure 1b).
  • Amy1A and Amy1C showed a similar pattern of expression in the high temperature plot, gradually increasing from 8 DAF and peaking at 15–20 DAF. Amy3A and Amy3D expression peaked around 15 DAF, while Amy3E showed high levels at 8–30 DAF in the high temperature plot. In contrast, the expression of Amy2A, Amy3B and Amy3C was not induced by high temperature (Figure 1b).
  • The intensity of the expression of all a-amylase genes in the course of grain filling clearly indicates that the newly characterized Amy3A gene was expressed at a considerable level under high temperature from 15 DA.

You can also add sub-section(s) at will.

Labs working on this gene

  • National Agricultural Research Center, Joetsu, Japan
  • RIKEN Plant Science Center, Tsurumi, Yokohama, Japan
  • Niigata University, Ikarashi, Niigata, Japan

References

  1. 1.0 1.1 Hakata M, Kuroda M, Miyashita T, et al. Suppression of α-amylase genes improves quality of rice grain ripened under high temperature.[J]. Plant Biotechnology Journal, 2012, 10(9):1110–1117.


Structured Information