|
|
| (8 intermediate revisions by 4 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os12g0281300''''' was reported as '''''Pi-ta''''' in 2000 <ref name="ref1" /> by researchers from New Zealand, USA and Netherlands. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os12g0281300''''' '''<=>''' '''''OsPi-ta,Pi-ta,Pita''''' |
| | ===Function=== | | ===Function=== |
| − | | + | * The rice blast resistance ( R ) gene Pi-ta mediates gene-for-gene resistance against strains of the fungus Magnaporthe grisea that express avirulent alleles of AVR-Pita . |
| − | The rice blast resistance gene, Pi-ta, originally introgressed into japonica from indica rice is important in breeding for rice blast resistance worldwide. In the southern USA, the rice cultivar Katy contains Pi-ta and is resistant to the predominant blast M. grisea races IB-49 and IC-17 and has been used as the blast resistant breeding parent. Three pairs of DNA primers specific to the dominant indica Pi-ta gene were designed to amplify the Pi-ta DNA fragments by polymerase chain reaction (PCR). | + | * Pi-ta encodes a predicted 928–amino acid cytoplasmic receptor with a centrally localized nucleotide binding site. |
| − | | + | |
| − | [[File:Figure 4. Blast symptoms of rice.png]]
| |
| − | | |
| − | Rice expressing the Pi-ta gene is resistant to strains of the rice blast fungus, Magnaporthe grisea, expressing AVR-Pita in a gene-for-gene relationship. Pi-ta encodes a putative cytoplasmic receptor with a centrally localized nucleotide-binding site and leucine-rich domain (LRD) at the C-terminus. AVR-Pita is predicted to encode a metalloprotease with an N-terminal secretory signal and pro-protein sequences. AVR-Pita176 lacks the secretory and pro-protein sequences.
| |
| − | | |
| − | [[File:Figure 3. Structure diagram of rice accessions carrying Pi-ta.png]]
| |
| − | | |
| − | In addition, the resistant Pi-ta allele (Pi-ta) found in the majority of US weedy rice belongs to the weedy group strawhull awnless (SH), suggesting a single source of origin for Pi-ta. Weeds with Pi-ta were resistant to two M. oryzae races, IC17 and IB49, except for three accessions, suggesting that component(s) required for the Pi-ta mediated resistance may be missing in these accessions.
| |
| − | | |
| | ===Expression=== | | ===Expression=== |
| − | | + | * Pi-ta shows low constitutive expression in both resistant and susceptible rice. |
| − | AVR-Pita176 protein is shown to bind specifically to the LRD of the Pi-ta protein, both in the yeast two-hybrid system and in an in vitro binding assay. Single amino acid substitutions in the Pi-ta LRD or in the AVR-Pita176 protease motif that result in loss of resistance in the plant also disrupt the physical interaction, both in yeast and in vitro.
| |
| − | | |
| − | | |
| − | [[File:Figure 2. Phylogenetic tree showing groups of US weedy rice among rice.png]]
| |
| − | | |
| − | The Pi-ta containing rice lines, as determined by PCR analysis, were resistant to both IB-49 and IC-17 in standard pathogenicity assays.
| |
| − | | |
| − | ===Evolution===
| |
| − | You can also add sub-section(s) at will.
| |
| − | Rice expressing the Pi-ta gene is resistant to strains of the rice blast fungus, Magnaporthe grisea, expressing AVR-Pita in a gene-for-gene relationship. Pi-ta encodes a putative cytoplasmic receptor with a centrally localized nucleotide-binding site and leucine-rich domain (LRD) at the C-terminus. AVR-Pita is predicted to encode a metalloprotease with an N-terminal secretory signal and pro-protein sequences. AVR-Pita176 lacks the secretory and pro-protein sequences.
| |
| − | | |
| − | [[File:Figure 5. Extended haplotype homozygosity (EHH) at and around Pi-ta.png]]
| |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | 1.Dale Bumpers National Rice Research Center, Agricultural Research Service, United States Department of Agriculture, Stuttgart, Arkansas, United States of America.
| + | * AgResearch Grasslands, Private Bag 11008,Palmerston North, New Zealand. |
| − | 2.Institute of Plant Biology, National Taiwan University, Taipei 106, Taiwan.
| + | * USDA-ARS, Dale Bumpers National Rice Research Center, Stuttgart, AR 72160 |
| − | 3.Department of Botany, National Museum of Natural Science, Taichung 404, Taiwan.
| + | * Plant Research International, Wageningen UR, Genomics Department, Droevendaalsesteeg 1, 6700 AA Wageningen, The Netherlands. |
| − | 4.Department of Life Science, National Taiwan Normal University, Taipei 116, Taiwan,
| |
| − | 5.Department of Life Science, Pingtung University of Science and Technology, Pingtung 912, Taiwan.
| |
| − | 6.Faculty of Agriculture, Hokkaido University, 060, Sapporo, Japan.
| |
| | | | |
| | ==References== | | ==References== |
| − | 1. Seonghee Lee;Yulin Jia;Melissa Jia;David R. Gealy;Kenneth M. Olsen;Ana L. Caicedo
| + | <references> |
| − | Molecular Evolution of the Rice Blast Resistance Gene Pi-ta in Invasive Weedy Rice in the USA
| + | * <ref name="ref1"> |
| − | PLoS ONE, 2011, 6(10): e26260
| + | Bryan GT, Wu KS, Farrall L, Jia Y, Hershey HP, McAdams SA, Faulk KN, Donaldson |
| − | 2. X. Wang;R. Fjellstrom;Y. Jia;W. G. Yan;M. H. Jia;B. E. Scheffler;D. Wu;Q. Shu;A. McClung
| + | GK, Tarchini R, Valent B. tA single amino acid difference distinguishes resistant |
| − | Characterization of Pi-ta blast resistance gene in an international rice core collection
| + | and susceptible alleles of the rice blast resistance gene Pi-ta. Plant Cell. 2000 |
| − | Plant Breeding, 2010, 129(5): 491-501
| + | Nov;12(11):2033-46. PubMed PMID: 11090207; PubMed Central PMCID: PMC150156. |
| − | 3. Yulin Jia;Rodger Martin
| + | </references> |
| − | Identification of a New Locus, Ptr(t), Required for Rice Blast Resistance Gene Pi-ta–Mediated Resistance
| |
| − | Molecular Plant-Microbe Interactions, 2008, 21(4): 396-403
| |
| − | 4. Chun-Lin Huang;Shih-Ying Hwang;Yu-Chung Chiang;Tsan-Piao Lin
| |
| − | Molecular Evolution of the Pi-ta Gene Resistant to Rice Blast in Wild Rice (Oryza rufipogon)
| |
| − | Genetics, 2008, 179(3): 1527-1538
| |
| − | 5. 王忠华;贾育林;吴殿星;夏英武
| |
| − | 水稻抗稻瘟病基因Pi-ta的分子标记辅助选择
| |
| − | 作物学报, 2004, 30(12): 1259-1265
| |
| − | 6. Yulin Jia;Zhonghua Wang;Pratibha Singh
| |
| − | Development of dominant rice blast Pi-ta resistance gene markers
| |
| − | Crop Science, 2002, 42(6): 2145-2149
| |
| − | 7. Yulin Jia;Sean A. McAdams;Gregory T. Bryan;Howard P. Hershey;Barbara Valent
| |
| − | Direct interaction of resistance gene and avirulence gene products confers rice blast resistance
| |
| − | The EMBO Journal, 2000, 19(15): 4004-4014
| |
| − | 8. Gregory T. Bryan;Kun-Sheng Wu;Leonard Farrall;Yulin Jia;Howard P. Hershey;Sean A. McAdams;Kristina N. Faulk;Gail K. Donaldson;Renato Tarchini;Barbara Valent
| |
| − | A Single Amino Acid Difference Distinguishes Resistant and Susceptible Alleles of the Rice Blast Resistance Gene Pi-ta
| |
| − | The Plant Cell, 2000, 12(11): 2033-2046
| |
| − | 9. Hittalmani-S;Parco-A;Mew-T-V;Zeigler-R-S;Huang-N
| |
| − | Fine mapping and DNA marker-assisted pyramiding of the three major genes for blast resistance in rice
| |
| − | Theoretical and Applied Genetics, 2000, 100(7): 1121-1128
| |
| − | 10. Inukai T;Zeigler R S;Sarkarung S;Bronson M;Dung L V;Kinoshita T;Nelson R J
| |
| − | Development of pre-isogenic lines for rice blast-resistance by marker-aided selection from a recombinant inbred population
| |
| − | Theoretical and Applied Genetics, 1996, 93(4): 560-567
| |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − |
| |
| − | {{JaponicaGene|
| |
| − | GeneName = Os12g0281300|
| |
| − | Description = Similar to Pi-ta protein|
| |
| − | Version = NM_001073106.1 GI:115488173 GeneID:4351983|
| |
| − | Length = 5556 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os12g0281300, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − |
| |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |1. Seonghee Lee;Yulin Jia;Melissa Jia;David R. Gealy;Kenneth M. Olsen;Ana L. Caicedo
| |
| − | Molecular Evolution of the Rice Blast Resistance Gene Pi-ta in Invasive Weedy Rice in the USA
| |
| − | PLoS ONE, 2011, 6(10): e26260
| |
| − | Chromosome = [[:category:Japonica Chromosome 12|Chromosome 12]]|
| |
| − | AP = Chromosome 12:10605422..10610977|
| |
| − | CDS = 10605623..10606017,10606490..10606533,10606706..10608424,10609890..10610833|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008405:10605422..10610977
| |
| − | source=RiceChromosome12
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008405:10605422..10610977
| |
| − | source=RiceChromosome12
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggcgccggcggtcagtgcatcgcagggtgtcatcatgcggtccctgacgagcaagctcgactcgctgctgctgcagccgccggagccgccgccgcctgcgcaaccgtcgtcgctgcggaagggggagaggaagaagatcctcctcctcagaggcgatctccgacacctgctagatgactactacctcctcgtggagccgccgtcagacaccgcgccaccgccagactcgacggcggcgtgctgggctaaggaggttcgcgagctctcctacgacgtcgacgacttcctcgacgagctaacgacccagctcctccaccaccgcggcggcggcgatggcagtagcactgctggtgccaagaagatgatcagcagcatgatcgcccggcttcgaggggagcttaaccggcggcggtggatcgccgacgaggtcaccctgttcagcgcccgcgtgaaggaggccattcgccgccaggagagctaccatcttggcaggcgcacctcgagctcgaggccgagagaagaagtcgacgacgacgatcgcgaggactccgccggcaacgaacgccgccggtttctgtcgctgacgttcgggatggacgacgctgctgtgcacggccagctcgttggtagggatatttcgatgcaaaagctcgtccggtggctggccgacggcgagccgaagctcaaggtggcttccattgttggatccggaggtgttggcaagacgacgctggccacagaattctatcgtctgcatggccggcggttggatgcgccgttcgactgccgggctttcgtgcggacgccccggaagcctgacatgacgaagatcctcaccgacatgctgtcacagctgcggccacaacatcagcatcagtcttcggatgtttgggaggttgatcgactccttgaaactatccggacgcatttgcaagataaaaggtacttcatcataattgaagatttatgggcttcatcaatgtgggatattgttagccgtggtttgcctgataataatagttgcagtagaatactaataacaacagaaattgaacctgtagctttggcatgctgtggatataactcagagcacattattaagattgatccactgggtgatgatgtctcaagtcaattgtttttcagtggagttgttggccaaggaaatgaatttcctggacatcttactgaagtttctcatgacatgataaaaaaatgtggtggcttgccactagcaataactataacagccagacattttaaaagccagctgttagatggaatgcagcaatggaatcacatacaaaaatcattgactacttccaatttgaagaaaaatcctactttgcaggggatgaggcaagtactcaaccttatttacaataatcttcctcattgtttgaaagcatgtctgttataccttagcatctacaaagaggactacataattaggaaggccaacttggtgaggcaatggatggctgaaggtttcatcaattccatagaaaataaagtcatggaagaagttgcagggaactattttgatgaacttgttggtaggggcctggtccaaccagtagatgttaactgcaaaaatgaggtattgtcatgtgtagtgcaccacatggtattaaatttcatcaggtgtaagtcaatagaggagaatttcagcattacattggatcattctcagacgacagtaagacatgctgacaaggttcgccgactctcgcttcacttcagcaatgcacatgatacaacaccactagcaggtttgagactctcacaagttcgatcgatggcatttttcggacaagtcaagtgtatgccttccattgcagattataggcttcttcgagttctgattctttgtttttgggctgatcaagagaaaacaagctatgacctcacaagcatttctgaactgttacaactgagatatctgaagataacaggtaatatcacagttaaacttccagagaagatccaaggactacaacacttgcagacactggaagcagatgcaagagcaactgctgtcctattggatattgttcatacacagtgtttgttgcaccttcgtcttgtactacttgatctgctccctcactgtcacaggtacatcttcaccagcatccccaaatggactggaaagctcaacaatctccgcattttaaacattgcagtcatgcaaatttcccaggatgaccttgacactctcaaaggactgggatctctcactgctctttcgctgcttgttcgaacagcgcctgcgcaaagaatcgtcgctgcgaatgaggggttcgggtctctcaagtacttcatgtttgtctgtacagcaccatgcatgacttttgtggaaggagcaatgccgagtgtgcaaagattaaatctaaggttcaatgccaacgagttcaagcagtatgactctaaggagacagggttggaacacttggtcgcccttgcagagatctctgcaagaattgggggcactgatgatgatgaatcaaacaaaactgaagtggagtctgccttgaggactgcaattcgcaagcatccgacgccgagcactcttatggttgatatacaatgggtggattggatctttggtgctgaagggagagacttggatgaagatttggcacaacaagatgatcacgggttttgtatgctaccggaatcctcttcacgtcttcagagtagagagataagtatcgaagaagacatgcccaccggtgcggaagggacggtgattgtgccccacacaatggagcagttcgccctccacatgagccaagccaagcaatcccacaagctcgtagtcatccagttcactacttcccggtgccctgcttcacgctacatcgcgccagctttcaccgagtatgcgaaggagttcgctggtgcggttttcattaaggtcaatgtcgacagcgatgagctggagagtgttacggactggtatgacatcgaagggatagtgccaacatttttcttcgtcaaggatggggagaagattgacaagattcctggtgctaacaaggagttgctccgagccaaaattcgaaggcacacagcttctccttacttcctccgttga</cdnaseq>|
| |
| − | AA = <aaseq>MAPAVSASQGVIMRSLTSKLDSLLLQPPEPPPPAQPSSLRKGER KKILLLRGDLRHLLDDYYLLVEPPSDTAPPPDSTAACWAKEVRELSYDVDDFLDELTT QLLHHRGGGDGSSTAGAKKMISSMIARLRGELNRRRWIADEVTLFSARVKEAIRRQES YHLGRRTSSSRPREEVDDDDREDSAGNERRRFLSLTFGMDDAAVHGQLVGRDISMQKL VRWLADGEPKLKVASIVGSGGVGKTTLATEFYRLHGRRLDAPFDCRAFVRTPRKPDMT KILTDMLSQLRPQHQHQSSDVWEVDRLLETIRTHLQDKRYFIIIEDLWASSMWDIVSR GLPDNNSCSRILITTEIEPVALACCGYNSEHIIKIDPLGDDVSSQLFFSGVVGQGNEF PGHLTEVSHDMIKKCGGLPLAITITARHFKSQLLDGMQQWNHIQKSLTTSNLKKNPTL QGMRQVLNLIYNNLPHCLKACLLYLSIYKEDYIIRKANLVRQWMAEGFINSIENKVME EVAGNYFDELVGRGLVQPVDVNCKNEVLSCVVHHMVLNFIRCKSIEENFSITLDHSQT TVRHADKVRRLSLHFSNAHDTTPLAGLRLSQVRSMAFFGQVKCMPSIADYRLLRVLIL CFWADQEKTSYDLTSISELLQLRYLKITGNITVKLPEKIQGLQHLQTLEADARATAVL LDIVHTQCLLHLRLVLLDLLPHCHRYIFTSIPKWTGKLNNLRILNIAVMQISQDDLDT LKGLGSLTALSLLVRTAPAQRIVAANEGFGSLKYFMFVCTAPCMTFVEGAMPSVQRLN LRFNANEFKQYDSKETGLEHLVALAEISARIGGTDDDESNKTEVESALRTAIRKHPTP STLMVDIQWVDWIFGAEGRDLDEDLAQQDDHGFCMLPESSSRLQSREISIEEDMPTGA EGTVIVPHTMEQFALHMSQAKQSHKLVVIQFTTSRCPASRYIAPAFTEYAKEFAGAVF IKVNVDSDELESVTDWYDIEGIVPTFFFVKDGEKIDKIPGANKELLRAKIRRHTASPY FLR</aaseq>|
| |
| − | DNA = <dnaseqindica>4961..5355#4445..4488#2554..4272#145..1088#agataggattaagtttcaagagttaatttcttgtactcttgggcgatccatgctgtcaaatcagcaactaacgaggcataatctcgatcactagctctgatctgatcttcagctagcgccggcgagctgcagaggtctccatccatggcgccggcggtcagtgcatcgcagggtgtcatcatgcggtccctgacgagcaagctcgactcgctgctgctgcagccgccggagccgccgccgcctgcgcaaccgtcgtcgctgcggaagggggagaggaagaagatcctcctcctcagaggcgatctccgacacctgctagatgactactacctcctcgtggagccgccgtcagacaccgcgccaccgccagactcgacggcggcgtgctgggctaaggaggttcgcgagctctcctacgacgtcgacgacttcctcgacgagctaacgacccagctcctccaccaccgcggcggcggcgatggcagtagcactgctggtgccaagaagatgatcagcagcatgatcgcccggcttcgaggggagcttaaccggcggcggtggatcgccgacgaggtcaccctgttcagcgcccgcgtgaaggaggccattcgccgccaggagagctaccatcttggcaggcgcacctcgagctcgaggccgagagaagaagtcgacgacgacgatcgcgaggactccgccggcaacgaacgccgccggtttctgtcgctgacgttcgggatggacgacgctgctgtgcacggccagctcgttggtagggatatttcgatgcaaaagctcgtccggtggctggccgacggcgagccgaagctcaaggtggcttccattgttggatccggaggtgttggcaagacgacgctggccacagaattctatcgtctgcatggccggcggttggatgcgccgttcgactgccgggctttcgtgcggacgccccggaagcctgacatgacgaagatcctcaccgacatgctgtcacagctgcggccacaacatcagcatcagtcttcggatgtttgggaggttgatcgactccttgaaactatccggacgcatttgcaagataaaaggtaattcatgtctacatctatctctagtatttttttcatgaatttacaaactattttctcaaatttccccttttttatccttcatatagtaattaagttagtaactatacatatgaatttaatttactcgacaatgccaataatattttaaattacttttatagtgccctctattagtagatacgattcgatcgagccatgaattatactggtaatctaaacaattattatacccacctcattctactaacagcaattgagttgttaatataaatagatatggtctattgcatgaaaaaataaaggtaaagtgtttacattatttctactactagtagaagaactacaaagttgtttgtatttttaattattaaatgtaaatgaaagtatatgtttcatacccttgttattttttttaggcgactaaactactagtacattatttctactactagtagaacaactacaaagttgtttgtatttttaattactaaatgtaaatgaaagtacatgcttcatacccttgttataattttttagactaaactaccacaatggcatgttaacttatagcagtaagttgtaatttattttcttttcattttctcagttgttacaagaacttttttttacttaataaaaaatagtcgtaagggcctcccttgttcggtcaaaaaagaattagactaaactcaatcgtatttgtacataaacaaaatttaaaatataactaaaacgaaacagtgataaaaatggtgcaatttaactgctgcctcttgttttaatgtctgacaatgttgattttgtatatatgtttggccatttattttattcaaattttttacaaatatgaaaaatataatatatgcttaaattacttttaatgataaaataaatttaaaaaaatgataattatatttttaataagatggatgatctaacatatatatgtccaaaagtttgacatcaaacattaaaaacaagagagagtatttgcttaggagtacgtgtctttttccatgtctaagaacaggtacaatagcaggttataagctagctataaacatattttaaagagatataggaagagagagaagagcagcagcctacagatctgtagccagctgcagcacggactctaagacgtaatgtgtgtatgacaggtaggaccaagtattaatagtatagtaagcaactattgtatgaattggctatttggctctagatgatttggagctagtagtcggctatactattaaacttgctcttagatatgtggttaaatttaatttctgaaatttacaagatatagaacatgtcttcaccatgtttgcaaagttgataaaatgaaattgcactcaactttttaaattcagcatgctatcccacgtatagctttttaaatatgatttattttttcgtacattagaagtttaatgtttacgaagtactaaatgttctgcaggtacttcatcataattgaagatttatgggcttcatcaatgtgggatattgttagccgtggtttgcctgataataatagttgcagtagaatactaataacaacagaaattgaacctgtagctttggcatgctgtggatataactcagagcacattattaagattgatccactgggtgatgatgtctcaagtcaattgtttttcagtggagttgttggccaaggaaatgaatttcctggacatcttactgaagtttctcatgacatgataaaaaaatgtggtggcttgccactagcaataactataacagccagacattttaaaagccagctgttagatggaatgcagcaatggaatcacatacaaaaatcattgactacttccaatttgaagaaaaatcctactttgcaggggatgaggcaagtactcaaccttatttacaataatcttcctcattgtttgaaagcatgtctgttataccttagcatctacaaagaggactacataattaggaaggccaacttggtgaggcaatggatggctgaaggtttcatcaattccatagaaaataaagtcatggaagaagttgcagggaactattttgatgaacttgttggtaggggcctggtccaaccagtagatgttaactgcaaaaatgaggtattgtcatgtgtagtgcaccacatggtattaaatttcatcaggtgtaagtcaatagaggagaatttcagcattacattggatcattctcagacgacagtaagacatgctgacaaggttcgccgactctcgcttcacttcagcaatgcacatgatacaacaccactagcaggtttgagactctcacaagttcgatcgatggcatttttcggacaagtcaagtgtatgccttccattgcagattataggcttcttcgagttctgattctttgtttttgggctgatcaagagaaaacaagctatgacctcacaagcatttctgaactgttacaactgagatatctgaagataacaggtaatatcacagttaaacttccagagaagatccaaggactacaacacttgcagacactggaagcagatgcaagagcaactgctgtcctattggatattgttcatacacagtgtttgttgcaccttcgtcttgtactacttgatctgctccctcactgtcacaggtacatcttcaccagcatccccaaatggactggaaagctcaacaatctccgcattttaaacattgcagtcatgcaaatttcccaggatgaccttgacactctcaaaggactgggatctctcactgctctttcgctgcttgttcgaacagcgcctgcgcaaagaatcgtcgctgcgaatgaggggttcgggtctctcaagtacttcatgtttgtctgtacagcaccatgcatgacttttgtggaaggagcaatgccgagtgtgcaaagattaaatctaaggttcaatgccaacgagttcaagcagtatgactctaaggagacagggttggaacacttggtcgcccttgcagagatctctgcaagaattgggggcactgatgatgatgaatcaaacaaaactgaagtggagtctgccttgaggactgcaattcgcaagcatccgacgccgagcactcttatggttgatatacaatgggtggattggatctttggtgctgaagggagagacttggatgaagatttggcacaacaagatgatcacgggtatggatttttcattctattcccaggttacaacttacaaggattattgagcttctttctttctctgccgtggcttctatctttaccttctatgcatcttcaacctgacttgatgattgtttgaaaccaattttaatggaagttaaatgttattgttgtgaccctgaatcaggttttgtatgctaccggaatcctcttcacgtcttcagagtagaggtaattttgtttcttgtcattttacagttacagttcatctacttaaggaattaatgggaggtcctatattttctcgggtacctagaaggtgtggttcctagtcttacctccttaagaaccgtagaatgttggccctaacacttggatcaaagaacgaaaggtgtatgcactatagtatcctttatatattgcacaagtcaagacatttgttaaaacacacccagtgctagtaatttgtttactgagatatgaattatcgccaaatacccatactgagcctattagtaaaatatttacgaggtgtttgaggacagcataactttcagtaaagaatttactacgtgaggtgtgtgttttaggtattgcgcatcttgggtgcattttagcgcaaacgtgtataatatatatcccatggtactaactcatgtcttaaccataattgcacaccaacacaaaacatacactactacagagataagtatcgaagaagacatgcccaccggtgcggaagggacggtgattgtgccccacacaatggagcagttcgccctccacatgagccaagccaagcaatcccacaagctcgtagtcatccagttcactacttcccggtgccctgcttcacgctacatcgcgccagctttcaccgagtatgcgaaggagttcgctggtgcggttttcattaaggtcaatgtcgacagcgatgagctggagagtgttacggactggtatgacatcgaagggatagtgccaacatttttcttcgtcaaggatggggagaagattgacaagattcctggtgctaacaaggagttgctccgagccaaaattcgaaggcacacagcttctccttacttcctccgttgataatgacttcttttatcgtctttgtctagtatatatatggcacttatatagttaactaggaagggcaccttgtttaatgtagctttcatttttattatgaatgttaaggatgatattatattgttgaagtatttttttactccttgtaaacatgtattggttaataacgaagtagtttggacattagttatgattttcttc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001073106.1 RefSeq:Os12g0281300]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |