Difference between revisions of "Os08g0155900"

From RiceWiki
Jump to: navigation, search
 
(5 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''Os08g0155900''' was reported as ''' OsDR10''' in 2009 <ref
  
 +
name="ref1" /> by researchers from the China.
 +
<br>
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''Os08g0155900 <=> OsDR10'''
 +
<br>
 
===Function===
 
===Function===
Please input function information here.
+
*'''OsDR10''',had homologs only in the closest relative, Leersia genus, but not other subfamilies of the grass family; therefore, it is a rice tribe-specific gene that may have originated de novo in the tribe.
 
+
*'''OsDR10'''-suppressed plants enhanced resistance to a broad spectrum of Xanthomonas oryzae pv. oryzae strains, which cause bacterial blight disease.  
===Expression===
+
<br>
Please input expression information here.
 
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan, China,
 
+
*Department of Ecology and Evolution, University of Chicago, Chicago, Illinois, United States of America
 +
<br>
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
<ref name="ref1">
 +
A Rice Gene of De Novo Origin Negatively Regulates Pathogen-Induced Defense Response</ref>
 +
</references>
 +
<br>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 8]]
GeneName = Os08g0155900|
 
Description = Conserved hypothetical protein|
 
Version = NM_001188460.1 GI:297726050 GeneID:9268924|
 
Length = 303 bp|
 
Definition = Oryza sativa Japonica Group Os08g0155900, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 8|Chromosome 8]]|
 
AP = Chromosome 8:3241962..3242264|
 
CDS = 3241962..3242264|
 
GCID = <gbrowseImage1>
 
name=NC_008401:3241962..3242264
 
source=RiceChromosome08
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008401:3241962..3242264
 
source=RiceChromosome08
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgttctacaagtacggcttcgccttcttggccggcaccggcttcggcgccgcgctcaccagcctccgccgcgacggcgacagctgctgccccatgcgccgccgccaccgccgctgtcgccgccgccacgacgacgacgaccagctggtcgacggcgacggcgaggctgcaggggaagagcgatacaaggagagcaagagggcgacgacgacgacgaatcccaaggccaagaagggcagcaccaaggagaaggcagctgctagtgttgctagggaggaggaggatgacgatgatgaatag</cdnaseq>|
 
AA = <aaseq>MAFYKYGFAFLAGTGFGAALTSLRRDGDSCCPMRRRHRRCRRRH                    DDDDQLVDGDGEAAGEERYKESKRATTTTNPKAKKGSTKEKAAASVAREEEDDDDE</aaseq>|
 
DNA = <dnaseqindica>1..303#atggcgttctacaagtacggcttcgccttcttggccggcaccggcttcggcgccgcgctcaccagcctccgccgcgacggcgacagctgctgccccatgcgccgccgccaccgccgctgtcgccgccgccacgacgacgacgaccagctggtcgacggcgacggcgaggctgcaggggaagagcgatacaaggagagcaagagggcgacgacgacgacgaatcccaaggccaagaagggcagcaccaaggagaaggcagctgctagtgttgctagggaggaggaggatgacgatgatgaatag</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001188460.1 RefSeq:Os08g0155900]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 8]]
 
[[Category:Chromosome 8]]
 

Latest revision as of 11:07, 13 November 2016

The rice Os08g0155900 was reported as OsDR10 in 2009 [1] by researchers from the China.

Annotated Information

Gene Symbol

  • Os08g0155900 <=> OsDR10


Function

  • OsDR10,had homologs only in the closest relative, Leersia genus, but not other subfamilies of the grass family; therefore, it is a rice tribe-specific gene that may have originated de novo in the tribe.
  • OsDR10-suppressed plants enhanced resistance to a broad spectrum of Xanthomonas oryzae pv. oryzae strains, which cause bacterial blight disease.


Labs working on this gene

  • National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan, China,
  • Department of Ecology and Evolution, University of Chicago, Chicago, Illinois, United States of America


References

  1. A Rice Gene of De Novo Origin Negatively Regulates Pathogen-Induced Defense Response


Structured Information