Difference between revisions of "Os08g0155900"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os08g0155900| Description = Conserved hypothetical protein| Version = NM_001188460.1 GI:297726050 GeneID:9268924| Length = 303 bp| Definition =...")
 
 
(6 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''Os08g0155900''' was reported as ''' OsDR10''' in 2009 <ref
GeneName = Os08g0155900|
 
Description = Conserved hypothetical protein|
 
Version = NM_001188460.1 GI:297726050 GeneID:9268924|
 
Length = 303 bp|
 
Definition = Oryza sativa Japonica Group Os08g0155900, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
name="ref1" /> by researchers from the China.
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
<br>
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
==Annotated Information==
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
===Gene Symbol===
|
+
*'''Os08g0155900 <=> OsDR10'''
Chromosome = [[:category:Japonica Chromosome 8|Chromosome 8]]|
+
<br>
AP = Chromosome 8:3241962..3242264|
+
===Function===
CDS = 3241962..3242264|
+
*'''OsDR10''',had homologs only in the closest relative, Leersia genus, but not other subfamilies of the grass family; therefore, it is a rice tribe-specific gene that may have originated de novo in the tribe.
GCID = <gbrowseImage1>
+
*'''OsDR10'''-suppressed plants enhanced resistance to a broad spectrum of Xanthomonas oryzae pv. oryzae strains, which cause bacterial blight disease.  
name=NC_008401:3241962..3242264
+
<br>
source=RiceChromosome08
+
 
preset=GeneLocation
+
==Labs working on this gene==
</gbrowseImage1>|
+
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan, China,
GSID = <gbrowseImage2>
+
*Department of Ecology and Evolution, University of Chicago, Chicago, Illinois, United States of America
name=NC_008401:3241962..3242264
+
<br>
source=RiceChromosome08
+
==References==
preset=GeneLocation
+
<references>
</gbrowseImage2>|
+
<ref name="ref1">
CDNA = <cdnaseq>atggcgttctacaagtacggcttcgccttcttggccggcaccggcttcggcgccgcgctcaccagcctccgccgcgacggcgacagctgctgccccatgcgccgccgccaccgccgctgtcgccgccgccacgacgacgacgaccagctggtcgacggcgacggcgaggctgcaggggaagagcgatacaaggagagcaagagggcgacgacgacgacgaatcccaaggccaagaagggcagcaccaaggagaaggcagctgctagtgttgctagggaggaggaggatgacgatgatgaatag</cdnaseq>|
+
A Rice Gene of De Novo Origin Negatively Regulates Pathogen-Induced Defense Response</ref>
AA = <aaseq>MAFYKYGFAFLAGTGFGAALTSLRRDGDSCCPMRRRHRRCRRRH                    DDDDQLVDGDGEAAGEERYKESKRATTTTNPKAKKGSTKEKAAASVAREEEDDDDE</aaseq>|
+
</references>
DNA = <dnaseqindica>1..303#atggcgttctacaagtacggcttcgccttcttggccggcaccggcttcggcgccgcgctcaccagcctccgccgcgacggcgacagctgctgccccatgcgccgccgccaccgccgctgtcgccgccgccacgacgacgacgaccagctggtcgacggcgacggcgaggctgcaggggaagagcgatacaaggagagcaagagggcgacgacgacgacgaatcccaaggccaagaagggcagcaccaaggagaaggcagctgctagtgttgctagggaggaggaggatgacgatgatgaatag</dnaseqindica>|
+
<br>
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001188460.1 RefSeq:Os08g0155900]|
+
 
}}
+
==Structured Information==
[[Category:Genes]]
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 8]]
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 8]]
 
[[Category:Chromosome 8]]
 

Latest revision as of 11:07, 13 November 2016

The rice Os08g0155900 was reported as OsDR10 in 2009 [1] by researchers from the China.

Annotated Information

Gene Symbol

  • Os08g0155900 <=> OsDR10


Function

  • OsDR10,had homologs only in the closest relative, Leersia genus, but not other subfamilies of the grass family; therefore, it is a rice tribe-specific gene that may have originated de novo in the tribe.
  • OsDR10-suppressed plants enhanced resistance to a broad spectrum of Xanthomonas oryzae pv. oryzae strains, which cause bacterial blight disease.


Labs working on this gene

  • National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan, China,
  • Department of Ecology and Evolution, University of Chicago, Chicago, Illinois, United States of America


References

  1. A Rice Gene of De Novo Origin Negatively Regulates Pathogen-Induced Defense Response


Structured Information