Difference between revisions of "Os08g0189200"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
 
(3 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''Os08g0189200''' was reported as ''' OsGLP8''' in 2009 <ref
  
 +
name="ref1" /> by researchers from the USA.
 +
<br>
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''Os08g0189200 <=> OsGLP8'''
 +
<br>
 
===Function===
 
===Function===
Please input function information here.
+
*Challenge with two different fungal pathogens (causal agents of rice blast and sheath blight diseases) revealed that as more chr 8 OsGLP genes were suppressed, disease susceptibility of the plants increased. Of the 12 chr 8 OsGLPs, one clustered subfamily (OsGER4) contributed most to resistance.
 +
<BR>
 +
===RNAi===
 +
*A highly conserved portion of the OsGLP coding region was used as an RNA interference trigger to silence a few to all expressed chr 8 OsGLP family members.
 +
<br>
  
===Expression===
+
==Labs working on this gene==
Please input expression information here.
+
*Bioagricultural Sciences and Pest Management and Program in Plant Molecular Biology, Colorado State University, Fort Collins, Colorado 80523–1177 (P.M.M., R.M.D, J.E.L.);
 
+
*Plant Pathology, Kansas State University, Manhattan, Kansas 66502–5502 (P.M.M.);
===Evolution===
+
*Rice Research Institute and Plant Protection Institute,Guangdong Academy of Agricultural Sciences, Guangzhou 510640, People’s Republic of China (B.L., X.Z.);
Please input evolution information here.
+
*Plant Pathology, Washington State University, Pullman, Washington 99164 (S.H.H.);
 +
*Plant Breeding,Genetics, and Biotechnology, International Rice Research Institute, Los Ban ˇos, 4031 Laguna, Philippines (H.L.).
 +
<br>
 +
==References==
 +
<references>
 +
<ref name="ref1">
 +
Characterization of a histidine- and alanine-rich protein showing
  
You can also add sub-section(s) at will.
+
interaction with calreticulin in rice
 +
</ref>
  
==Labs working on this gene==
+
</references>
Please input related labs here.
+
<br>
 
 
==References==
 
Please input cited references here.
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 8]]
GeneName = Os08g0189200|
 
Description = Similar to Oxalate oxidase (Fragment)|
 
Version = NM_001067692.1 GI:115475120 GeneID:4344839|
 
Length = 1073 bp|
 
Definition = Oryza sativa Japonica Group Os08g0189200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 8|Chromosome 8]]|
 
AP = Chromosome 8:5221233..5222305|
 
CDS = 5221278..5221398,5221557..5222113|
 
GCID = <gbrowseImage1>
 
name=NC_008401:5221233..5222305
 
source=RiceChromosome08
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008401:5221233..5222305
 
source=RiceChromosome08
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcctcctcttccttatttctgctagcttctcttcttgttctggcctcatggcagcaggccatcgcctttgatcctagcccgctccaagatttctgcgtcgccgacatggcctcacctgtgcgagtaaatgggtttccttgcaagaacccaatgaatgtcacatcggacgacttcttcaacgcggccaagtttgacatgccaaggaatactatgaataaagtcgggtctaatgtcaccaacctcaacgtcatcaatttcccgggcctcaacactcttggcatctcactagctcgcatcgactacgcgccaatgggtgtcaacccaccacatgtgcatcctcgtgctactgagcttctcactgtgcttgagggaacactttatgttggttttgttacatccaaccctaacaggctcttctccaaggtggtgcataagggtgatgtgttcgtgttccctaaggcaatgattcactttcaaatgaacctagaccacaataagcctgcggttgcccaatcagcactcagcagtcaaaacccaggagttattactattgctagtgccatatttggatcaacgccaccaatctctgatgatgttttagtcaaggcatttcaagtggagaagaaggtgattgattggctgaagtctcaattctcggagaataaccactactga</cdnaseq>|
 
AA = <aaseq>MASSSLFLLASLLVLASWQQAIAFDPSPLQDFCVADMASPVRVN                    GFPCKNPMNVTSDDFFNAAKFDMPRNTMNKVGSNVTNLNVINFPGLNTLGISLARIDY                    APMGVNPPHVHPRATELLTVLEGTLYVGFVTSNPNRLFSKVVHKGDVFVFPKAMIHFQ                    MNLDHNKPAVAQSALSSQNPGVITIASAIFGSTPPISDDVLVKAFQVEKKVIDWLKSQ                    FSENNHY</aaseq>|
 
DNA = <dnaseqindica>46..166#325..881#caaaataacgataaacacagggagagagagagagaaagaaattcaatggcctcctcttccttatttctgctagcttctcttcttgttctggcctcatggcagcaggccatcgcctttgatcctagcccgctccaagatttctgcgtcgccgacatggcctcacctggtgtgcacacttaatttaactattatcctaatgttcggtagtattttatcactgcttattgaaaattgtatgttttgcatagtggcactacacaaaaatatggctcttgtggctactcaaaactttaacatgtttccttcttttttctatgcaaacagtgcgagtaaatgggtttccttgcaagaacccaatgaatgtcacatcggacgacttcttcaacgcggccaagtttgacatgccaaggaatactatgaataaagtcgggtctaatgtcaccaacctcaacgtcatcaatttcccgggcctcaacactcttggcatctcactagctcgcatcgactacgcgccaatgggtgtcaacccaccacatgtgcatcctcgtgctactgagcttctcactgtgcttgagggaacactttatgttggttttgttacatccaaccctaacaggctcttctccaaggtggtgcataagggtgatgtgttcgtgttccctaaggcaatgattcactttcaaatgaacctagaccacaataagcctgcggttgcccaatcagcactcagcagtcaaaacccaggagttattactattgctagtgccatatttggatcaacgccaccaatctctgatgatgttttagtcaaggcatttcaagtggagaagaaggtgattgattggctgaagtctcaattctcggagaataaccactactgattatatcatgtttcttgattgttcctttgtgcgttataatatgtataataaatgggcttttgcctagttgatgtcatggtatgctaaaacagtatgtttgatcgtccatgtttaataaatgtaatgcaatatggacacagtacggcgtccttttcctaattatatattaatataaaagaatgattgttcatg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001067692.1 RefSeq:Os08g0189200]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 8]]
 
[[Category:Chromosome 8]]
 

Latest revision as of 11:24, 13 November 2016

The rice Os08g0189200 was reported as OsGLP8 in 2009 [1] by researchers from the USA.

Annotated Information

Gene Symbol

  • Os08g0189200 <=> OsGLP8


Function

  • Challenge with two different fungal pathogens (causal agents of rice blast and sheath blight diseases) revealed that as more chr 8 OsGLP genes were suppressed, disease susceptibility of the plants increased. Of the 12 chr 8 OsGLPs, one clustered subfamily (OsGER4) contributed most to resistance.


RNAi

  • A highly conserved portion of the OsGLP coding region was used as an RNA interference trigger to silence a few to all expressed chr 8 OsGLP family members.


Labs working on this gene

  • Bioagricultural Sciences and Pest Management and Program in Plant Molecular Biology, Colorado State University, Fort Collins, Colorado 80523–1177 (P.M.M., R.M.D, J.E.L.);
  • Plant Pathology, Kansas State University, Manhattan, Kansas 66502–5502 (P.M.M.);
  • Rice Research Institute and Plant Protection Institute,Guangdong Academy of Agricultural Sciences, Guangzhou 510640, People’s Republic of China (B.L., X.Z.);
  • Plant Pathology, Washington State University, Pullman, Washington 99164 (S.H.H.);
  • Plant Breeding,Genetics, and Biotechnology, International Rice Research Institute, Los Ban ˇos, 4031 Laguna, Philippines (H.L.).


References

  1. Characterization of a histidine- and alanine-rich protein showing interaction with calreticulin in rice


Structured Information