Difference between revisions of "Os03g0196500"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os03g0196500| Description = Cyclin-like F-box domain containing protein| Version = NM_001055799.1 GI:115451326 GeneID:4331940| Length = 537 bp| ...")
 
 
(4 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''Os03g0196500''' was reported as '''gid2''' in 2005 <ref name="ref1" /> by researchers from the USA.
GeneName = Os03g0196500|
+
<br>
Description = Cyclin-like F-box domain containing protein|
+
==Annotated Information==
Version = NM_001055799.1 GI:115451326 GeneID:4331940|
+
===Gene Symbol===
Length = 537 bp|
+
*'''Os03g0196500<=> gid2'''
Definition = Oryza sativa Japonica Group Os03g0196500, complete gene.|
+
<br>
Source = Oryza sativa Japonica Group
+
===Function===
 +
*The '''GID2''' gene encodes a putative F-boxprotein, which interacted with the rice Skp1 homolog in a yeast two-hybrid assay.
 +
*'''GID2''' is a positive regulator of GA signaling and that regulated degradation of SLR1 is initiated through GA-dependent phosphorylation and finalized by an SCFGID2-proteasome pathway.
 +
<br>
  
  ORGANISM  Oryza sativa Japonica Group
+
==Labs working on this gene==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
*BioScience Center, Nagoya University, Nagoya 464-8601, Japan.
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
*BioResources Center, Riken, Tsukuba 305-0074, Japan.  
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
*Division of Molecular and Life Science, Pohang University of Science and Technology, Pohang 790-784, Republic of Korea.  
|
+
*Graduate School of Bioagricultural Science, Nagoya University, Nagoya 464-8601, Japan.
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
+
<br>
AP = Chromosome 3:5076590..5077126|
+
==References==
CDS = 5076590..5077126|
+
<references>
GCID = <gbrowseImage1>
+
<ref name="ref1">
name=NC_008396:5076590..5077126
+
Accumulation of Phosphorylated Repressor for Gibberellin Signaling in an F-box Mutant
source=RiceChromosome03
+
</ref>
preset=GeneLocation
+
 
</gbrowseImage1>|
+
</references>
GSID = <gbrowseImage2>
+
<br>
name=NC_008396:5076590..5077126
+
==Structured Information==
source=RiceChromosome03
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 3]]
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgggtgcacggccagtaccgcggcgggaggaggtggtggtcgtgacggagctggagctgcggatgcagctgctcggcggcggcggcaactgctacaacatcaacgacaacgccgacctcctcgcggagatcctggcgcggctggacggccgctcgctcgccgccgccgcctgcgtgtgccgcctctgggccgccgtggcgcgccgggacgccgtctgggaggcgctctgcctccgccacgtggggccggcgtccggccccacggccggccccgccacccgcgccgtcgtcgccgcgctcggcgggtaccgccgcctctaccgcctctgcctcggcccggcgctggaccgcctcgggcgcggcggcggcgccatcgcccacgcgcacgccagggcccgcctgtccctctccctctcgctgtcgctcttctccatcgactgctacgagcgcctcggcggcggtggcggcgccggcgccggcaggcagccgcagccgtcgtcactgctcttcctgtgcaagccagtggacgtctcgtga</cdnaseq>|
 
AA = <aaseq>MGARPVPRREEVVVVTELELRMQLLGGGGNCYNINDNADLLAEI                    LARLDGRSLAAAACVCRLWAAVARRDAVWEALCLRHVGPASGPTAGPATRAVVAALGG                    YRRLYRLCLGPALDRLGRGGGAIAHAHARARLSLSLSLSLFSIDCYERLGGGGGAGAG                    RQPQPSSLLFLCKPVDVS</aaseq>|
 
DNA = <dnaseqindica>1..537#atgggtgcacggccagtaccgcggcgggaggaggtggtggtcgtgacggagctggagctgcggatgcagctgctcggcggcggcggcaactgctacaacatcaacgacaacgccgacctcctcgcggagatcctggcgcggctggacggccgctcgctcgccgccgccgcctgcgtgtgccgcctctgggccgccgtggcgcgccgggacgccgtctgggaggcgctctgcctccgccacgtggggccggcgtccggccccacggccggccccgccacccgcgccgtcgtcgccgcgctcggcgggtaccgccgcctctaccgcctctgcctcggcccggcgctggaccgcctcgggcgcggcggcggcgccatcgcccacgcgcacgccagggcccgcctgtccctctccctctcgctgtcgctcttctccatcgactgctacgagcgcctcggcggcggtggcggcgccggcgccggcaggcagccgcagccgtcgtcactgctcttcctgtgcaagccagtggacgtctcgtga</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055799.1 RefSeq:Os03g0196500]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 3]]
 
[[Category:Chromosome 3]]
 

Latest revision as of 09:09, 15 November 2016

The rice Os03g0196500 was reported as gid2 in 2005 [1] by researchers from the USA.

Annotated Information

Gene Symbol

  • Os03g0196500<=> gid2


Function

  • The GID2 gene encodes a putative F-boxprotein, which interacted with the rice Skp1 homolog in a yeast two-hybrid assay.
  • GID2 is a positive regulator of GA signaling and that regulated degradation of SLR1 is initiated through GA-dependent phosphorylation and finalized by an SCFGID2-proteasome pathway.


Labs working on this gene

  • BioScience Center, Nagoya University, Nagoya 464-8601, Japan.
  • BioResources Center, Riken, Tsukuba 305-0074, Japan.
  • Division of Molecular and Life Science, Pohang University of Science and Technology, Pohang 790-784, Republic of Korea.
  • Graduate School of Bioagricultural Science, Nagoya University, Nagoya 464-8601, Japan.


References

  1. Accumulation of Phosphorylated Repressor for Gibberellin Signaling in an F-box Mutant


Structured Information