|
|
| (3 intermediate revisions by 3 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''Os03g0119966''' was reported as ''' rim1''' in 2008 <ref name="ref1" /> by researchers from the Japan. |
| − | RIM1 is related to resistance to rice dwarf virus (RDV). Its encoding product RIM factor act as host factor, which is indispensable for RDV increase in rice.
| + | <br> |
| | ==Annotated Information== | | ==Annotated Information== |
| − | ===Phenotype characters=== | + | ===Gene Symbol=== |
| − | We can get a mutant of rice rim1-1 which resistant to rice dwarf virus by insertion of Tos17. Compared with wild type, the mutant exhibit no dwarf, relatively slow growth, root short, apex sometimes curled up. Mutant rim1-1 only resistant to rice dwarf virus, while not to yellow leaves of rice and rice stripe virus. Over-expression of RIM1 transgenic leads to more sensitiveness to rice dwarf virus(Yoshii et al, 2009).
| + | *'''Os03g0119966 <=> rim1''' |
| − | ===Gene cloning and function analysis=== | + | <br> |
| − | Please input function information here.Rim1-1
| + | ===Function=== |
| − | Using bioinformatics analysis and complementary functions tests, showing that is mutant rim1-1 resulted from the second intron of Os03g0119966 gene of Tos17 insertion. Os03g0119966 is named RIM1, the length of ORF is 1953 bp, which contains 7 extrons, it's initial condon starts from the second extron.
| + | *'''RIM1''' functions as a host factor that is required for multiplication of RDV in rice. |
| − | RIM1 has two forms of transcripts, while in the mutants, the contents of those two transcripts is significantly reduced. (Yoshii et al, 2009).RIM1 coding product belongs to the NAC transcription factors, which is homology with arabidopsis ANAC028, and there is no similar genes found in the rice before. RIM1 contains five conservative subregion, nuclear location signal domain and C base side un-conservative area(Yoshii et al, 2009).
| + | <br> |
| − | Whether vaccination RDV or not, some classic host defend genes, for example, PR10a, PR5 and PAL can not be activated by mutant rim1-1, which suggests that
| + | ===Mutant=== |
| − | RIM1 has noting to do with defensive response of effector. Using empoasca carrying rice dwarf virus to vaccinate, we found that mutant rim1-1 also appears same disease spots the wild type. This suggest that mutant rim1-1 has no resistantance to empoasca, while only resistant to rice dwarf virus itself. Mutant
| + | *The '''rim1-1''' mutant remained susceptible to the two other viruses tested, one ofm which is also transmitted by leafhoppers, suggesting that the multiplication rather than transmission of RDV is specifically impaired in this mutant. |
| − | rim1-1 does not resistant to rice yellow virus which same carried by empoasca. Also no resistantance to rice stripe virus by the spread of BPH. This shows that mutant rim1-1 only inhibit the rice dwarf virus proliferation and has not influence to the spread of the virus.
| + | <br> |
| − | Rice NAC transcription factor RIM1 is a regulatory factor of jasmonic acid signal transduction pathways(Yoshii et al., 2010).
| |
| − | ===Expression===
| |
| − | Please input expression information here.
| |
| − | | |
| − | ===Evolution===
| |
| − | Please input evolution information here.
| |
| − | | |
| − | You can also add sub-section(s) at will.
| |
| − | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | *National Agricultural Research Center, Tsukuba, Ibaraki 305-8666, Japan, |
| | + | *National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan |
| | + | <br> |
| | + | ==References== |
| | + | <references> |
| | + | <ref name="ref1"> |
| | + | Disruption of a novel gene for a NAC-domain protein in rice confers resistance to Rice dwarf virus |
| | + | </ref> |
| | | | |
| − | ==References==
| + | </references> |
| − | Please input cited references here.
| + | <br> |
| − | 1. Motoyasu Yoshii;Muneo Yamazaki;Randeep Rakwal;Mitsuko Kishi-Kaboshi;Akio Miyao;Hirohiko Hirochika. The NAC transcription factor RIM1 of rice is a new regulator of jasmonate signaling. The Plant Journal, 2010, 61(5): 804-815
| |
| − | 2. Motoyasu Yoshii;Takumi Shimizu;Muneo Yamazaki;Takahiko Higashi;Akio Miyao;Hirohiko Hirochika;Toshihiro Omura. Disruption of a novel gene for a NAC-domain protein in rice confers resistance to Rice dwarf virus. The Plant Journal, 2009, 57(4): 615-625
| |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 03]] |
| − | GeneName = Os03g0119966|
| |
| − | Description = Similar to OsNAC8 protein|
| |
| − | Version = NM_001186312.1 GI:297721754 GeneID:9270943|
| |
| − | Length = 3958 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os03g0119966, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
| |
| − | AP = Chromosome 3:1067800..1071757|
| |
| − | CDS = 1067800..1067956,1069447..1069724,1069910..1070266,1070370..1070783,1070885..1070966<br>,1071093..1071757|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008396:1067800..1071757
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008396:1067800..1071757
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggcgcccgtgagtttgcctccaggtttcaggttccaccccaccgatgaagaactaatcatctactaccttaagcggaagatcaacggaagacagatagaactcgaaatcattccagaggttgatctttacaagtgtgagccttgggatctgcctgaaaaatcctttcttccgagtaaagatctcgaatggtacttcttcagccctagagaccgcaagtacccaaatggatcaaggacgaaccgtgcaacaaaagccggatactggaaggcaactgggaaagatcgaaaagtgaactcacagaggcgtgcagttggtatgaagaagactcttgtgtactaccgtggtcgagctccacatggttctcgcaccgattgggtcatgcacgagtaccgcctcgatgagagggaatgcgagactgacactggcttacaggatgcatatgctttatgccgggtgttcaagaagacagcgcccgggccaaagatcatagagcattatggtgtggtgcaccaccatgtcgagcaacctcaatggatgacgagcagtatcgatcgctccccaacgttggacgtgtcgtgtgatggaagaggtgatgactttgagagcagcagcttctctttcccaacagagacgccaatggactccatgcacggtgggtttggaatgcagatgagtgcacctcacgaggatggcaaatggatgcagtttctgagtgaagatgccttcaacgccaccaatccattcttgacgaacccagtttctgccaacttctcatgccttccatccaaggtggatgttgcactggaatgtgcgaggctgcagcacaggctcaccttgcctcccttggaggtggaggatttcccacaggacgtcagccttgacacgaagattggcatacttcgcagtaaccccaacgaagttgacattctccaagaattcctgtcagttgcgactgcctctcaggagctaattaatggctccaccagtagctaccctgaaatgtggttaggagctagcacaagcagtgctagctacgtcaatgaactgtcctctctagttgagatgggcggcgttggcacttctaaccaccacgaatccgcaaggctacaggtcgagatcgctgacatggaggtgttcaaggacgagaagaagcgggtggagaaccttagaggagtcaagttggtgaacaatgaccttggggagattgttgtagaaggagatgaaagcaatccaacagaagacatcatcgcgcagtaccctataaaagtcactgcagataattcaggagaagccggtcatcgcatgaccgatcccactgacgtaggcggcatcgacactgccccgatcttctcgcaatctcaacctgacgactttgctgctggtttcgacgacgtcaaccctaatgcatctttcgatctgtacgagaaggttgacgtcaaccacaggctattcgtttcaagggtcgctgcggcgaagacattcttccaccgcattgagccatcgaagaaggtcagcttccactcgaacccggcagcaaccgccgtcagtaaggcgaccgagaagttccatttccccgttacgaccaaagttagtggtagggtttccatttttagcaagttcaaggcactcataagggacaagttcttgatgatgaggccatcacattcataccaaaggttgggcagcaaagaaaccacagtgaatgagctgctgcagattgtgtcactccttttagcaccgaagcaaatcaatggctgccctactgagcaagagctggtcaagaagaaggcgaaagaagtgatgaagccgggatggggtcgtgaagggagcaacaaattgtggcttccgctctccaaagggaagggcatttccagcatgtttttgagtgggaaatggacgtttctaacctccgcgttggccatcagcactccagctgagtgcgatcactaa</cdnaseq>|
| |
| − | AA = <aaseq>MAPVSLPPGFRFHPTDEELIIYYLKRKINGRQIELEIIPEVDLY KCEPWDLPEKSFLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVNSQR RAVGMKKTLVYYRGRAPHGSRTDWVMHEYRLDERECETDTGLQDAYALCRVFKKTAPG PKIIEHYGVVHHHVEQPQWMTSSIDRSPTLDVSCDGRGDDFESSSFSFPTETPMDSMH GGFGMQMSAPHEDGKWMQFLSEDAFNATNPFLTNPVSANFSCLPSKVDVALECARLQH RLTLPPLEVEDFPQDVSLDTKIGILRSNPNEVDILQEFLSVATASQELINGSTSSYPE MWLGASTSSASYVNELSSLVEMGGVGTSNHHESARLQVEIADMEVFKDEKKRVENLRG VKLVNNDLGEIVVEGDESNPTEDIIAQYPIKVTADNSGEAGHRMTDPTDVGGIDTAPI FSQSQPDDFAAGFDDVNPNASFDLYEKVDVNHRLFVSRVAAAKTFFHRIEPSKKVSFH SNPAATAVSKATEKFHFPVTTKVSGRVSIFSKFKALIRDKFLMMRPSHSYQRLGSKET TVNELLQIVSLLLAPKQINGCPTEQELVKKKAKEVMKPGWGREGSNKLWLPLSKGKGI SSMFLSGKWTFLTSALAISTPAECDH</aaseq>|
| |
| − | DNA = <dnaseqindica>1..157#1648..1925#2111..2467#2571..2984#3086..3167#3294..3958#atggcgcccgtgagtttgcctccaggtttcaggttccaccccaccgatgaagaactaatcatctactaccttaagcggaagatcaacggaagacagatagaactcgaaatcattccagaggttgatctttacaagtgtgagccttgggatctgcctggtatgttcttagtttgcttgttctaaagatatctattcctagtttttatgttgcttgttggtggtagaagttagaatgctgtagcccatgctaggatatatatatttcaatccaaccctaggcccatgcagctatcaccaattggcgttcttatatatcattctcttgctatataggagtaacagtttctttctttttgttttaagggtaggaatagcagtttcatgatatataatttgtatgagacttttgtataaatgctataaggacaagttttaagtttatatgcatgttaaaattcaggttaacaattaactataggcaagcatgcacctttattgttctccaaggaaagcacatatataggtccagtatgtttattggatgccgtgttatgtagacactaagcaatcttattcaattcttatactattatgccctcccaagaaacaccagtgcctacactacttgaggaaagaataaccacatgttcccttcttgatgagcacttcatctagctatttgtagttgaaatgtatgtaataataatcactaattaatcctggctataaatgtgtagctctatctgttgttttagtttttcttttatttcacataagtagcttttatgtcatttatgtcacaaaagaaaaggtttccatgattaattcgtaaattttggtacatttgaattgctagttatatcaaagcatatttgattttttttctctttatatataaaaaatcaagcattgtcaaaagcgatgtttcactgtcatagctttgtgtgaaaacaagattaatcatactgtgaaatttgctttactttcaaacatcttatgcacaccgaaaggagggatattgatagatcttgatccttttgtcaaaagaaatttaccttcaaaaagaaacgtcaaatttctgccaagtgtaaaggtgacattatatacgtccatgcactgagatacttgaaatggaaaataaatcctttatatcagtaacatcaaagttaaagtttatatattttggaccatgtcacaatcacagagagatttgaggaaaagatatattctctctttatccacttgctgtttgctttcaagcttgacagtttactacaaaaacaccatgtagcattcaacattctacgaagcgagtgctgtaaaaatatcgaataaaaagagaaaataaagatgagccttttttcttggggtgacaaaataaagcaagaaactaagaaaggaacttgtgatgaacatataggtcaagaagatgaacaaaagtccgcacagcctccaagagatataaagtgaccttggtctaattttctttcagctatggtgggctatcatgttaaatagccatatcttaactctgtcattagatccaatcatgatagtagacaagtacttcaatgtttatgctgcatgcatgattatgtatgactttttgtttgtatgacaccccctaactgatcgttcaatattcagaaaaatcctttcttccgagtaaagatctcgaatggtacttcttcagccctagagaccgcaagtacccaaatggatcaaggacgaaccgtgcaacaaaagccggatactggaaggcaactgggaaagatcgaaaagtgaactcacagaggcgtgcagttggtatgaagaagactcttgtgtactaccgtggtcgagctccacatggttctcgcaccgattgggtcatgcacgagtaccgcctcgatgagagggaatgcgagactgacactggcttacaggtgtgttactattaatcttgttgcatttttaaatctacaaccataatatatggataaaccatatatgttatatttagcccttcttttctgaaattataaacctagagtaaaatatgttactagctgcttgacatggacgcggcctctgatatgcaacctctttgcatttgtgtgtctatatgtaggatgcatatgctttatgccgggtgttcaagaagacagcgcccgggccaaagatcatagagcattatggtgtggtgcaccaccatgtcgagcaacctcaatggatgacgagcagtatcgatcgctccccaacgttggacgtgtcgtgtgatggaagaggtgatgactttgagagcagcagcttctctttcccaacagagacgccaatggactccatgcacggtgggtttggaatgcagatgagtgcacctcacgaggatggcaaatggatgcagtttctgagtgaagatgccttcaacgccaccaatccattcttgacgaacccagtttctgccaacttctcatgccttccatccaaggtacatatacatatatagtcaaaaatgaaggttacttactggtacagatgacatgtatattcaggcaatgagttcttaccggtgcaatgatattcatatgcaggtggatgttgcactggaatgtgcgaggctgcagcacaggctcaccttgcctcccttggaggtggaggatttcccacaggacgtcagccttgacacgaagattggcatacttcgcagtaaccccaacgaagttgacattctccaagaattcctgtcagttgcgactgcctctcaggagctaattaatggctccaccagtagctaccctgaaatgtggttaggagctagcacaagcagtgctagctacgtcaatgaactgtcctctctagttgagatgggcggcgttggcacttctaaccaccacgaatccgcaaggctacaggtcgagatcgctgacatggaggtgttcaaggacgagaagaagcgggtggagaaccttagaggagtcaagttggtgaacaatgaccttggggaggtaattgtttgcatcatacctatacaagtatattcccatcattatatatatactacatctcatgagactgattactttcatgcttcatttgtctcaagcagattgttgtagaaggagatgaaagcaatccaacagaagacatcatcgcgcagtaccctataaaagtcactgcagataattcaggtatgtaatatttaattttggctgttttacatgggctccacagaagtaattagcagtattccatattcgatacagactgtatacagatacagttcttgcatgcactaactcagagctagattgcaggagaagccggtcatcgcatgaccgatcccactgacgtaggcggcatcgacactgccccgatcttctcgcaatctcaacctgacgactttgctgctggtttcgacgacgtcaaccctaatgcatctttcgatctgtacgagaaggttgacgtcaaccacaggctattcgtttcaagggtcgctgcggcgaagacattcttccaccgcattgagccatcgaagaaggtcagcttccactcgaacccggcagcaaccgccgtcagtaaggcgaccgagaagttccatttccccgttacgaccaaagttagtggtagggtttccatttttagcaagttcaaggcactcataagggacaagttcttgatgatgaggccatcacattcataccaaaggttgggcagcaaagaaaccacagtgaatgagctgctgcagattgtgtcactccttttagcaccgaagcaaatcaatggctgccctactgagcaagagctggtcaagaagaaggcgaaagaagtgatgaagccgggatggggtcgtgaagggagcaacaaattgtggcttccgctctccaaagggaagggcatttccagcatgtttttgagtgggaaatggacgtttctaacctccgcgttggccatcagcactccagctgagtgcgatcactaa</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001186312.1 RefSeq:Os03g0119966]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]]
| |
| − | [[Category:Japonica Chromosome 3]] | |
| − | [[Category:Chromosome 3]]
| |